SecReT6
Protein ID: 565642700
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07595
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1370916..1371563 [+]
Producthypothetical protein
NoteIglJ
UniProt IDV5VYZ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 215 a.a.     [Download]
>gi|565642700|ref|YP_008893546.1| hypothetical protein M973_07595 [Francisella noatunensis subsp. orientalis LADL--07-285A]
MNIENLNRICHKLSLNHLLRIFLVYNIQTKNMRFEPILMDSTAAATILRISRKQEHIYIDINVFKLKPFA
RLEVRYQEYIHDNNDLALEVLEYSIRSLLYRYIIRTKELHRLTQNNSYIKAAPKFTIDNTINALYKVLSE
DYCTIINYEKELVKIKRSPSLVGQKNIGNIYIGGYITSFIYLIKVNIILLNKNHKDVKRIKTRIKIIKKI
LEITQ
 
Nucleotide Sequence: 648 bp     [Download]
>gi|565641727|ref|NC_023029.1|:1370916-1371563 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGAATATAGAAAATTTAAATAGAATATGTCATAAACTTTCTCTTAATCATCTTCTTAGAATTTTTTTAG
TCTACAATATTCAAACCAAAAATATGAGATTTGAACCAATCTTAATGGATAGCACGGCAGCAGCTACTAT
CCTTAGAATCTCGAGAAAACAAGAACATATATATATTGATATAAATGTTTTCAAACTCAAACCTTTTGCG
AGATTAGAGGTAAGATATCAGGAGTACATCCATGATAATAACGATTTAGCTCTTGAAGTATTAGAGTATA
GTATTAGATCCTTATTGTATAGATATATTATAAGAACTAAAGAATTACATAGGTTAACTCAAAACAACTC
TTATATTAAAGCAGCTCCTAAGTTTACTATTGATAATACAATAAATGCTTTATATAAAGTCTTAAGTGAA
GATTACTGTACTATCATAAACTATGAAAAGGAACTAGTTAAAATCAAAAGATCTCCTTCTCTTGTTGGGC
AAAAAAATATTGGCAATATCTATATTGGTGGATATATAACTTCTTTTATATATTTAATTAAAGTAAATAT
AATTCTTTTAAATAAAAATCATAAGGATGTAAAGCGAATAAAGACTAGAATTAAGATAATTAAAAAAATA
TTAGAAATAACTCAATAA