SecReT6
Protein ID: 565642701
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07600
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1371647..1372843 [-]
Productintracellular growth locus protein D
NoteIglD
UniProt IDV5W0F9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 398 a.a.     [Download]
>gi|565642701|ref|YP_008893547.1| intracellular growth locus protein D [Francisella noatunensis subsp. orientalis LADL--07-285A]
MFLERIYWEDGLRLDRDILDQSNLSILERSKSASYLPANLNKGILSFDLDIESLQTGLIIIKDLVLYLDE
KTFIFYDKCYPLSLQIVTDELTNDIPLFLNVNEKIVEKEGVKYIHNQLSLSLEHDYSVKYSTQIALFKLD
RGKLVSDTYDFPLLTLNHYSMHDIFIKLNRIVSELKSFNRFVFSTSRSYAAILLVFLINKLERELKFAES
NKLNGSPKQIFDLVHDIYSLIQLNLDKVEDVDNIEFDFYKPIRKINLLAHRLLTLCEYRKINNFIKFELQ
GKKYLCENFPEEFFVATRYYIFIKRKATVPANVKFENKKAMRITSISRNKNVVTLSLSGVKLVEVEHSMM
NFTTRVDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFGFFIAFT
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|565641727|ref|NC_023029.1|:c1372843-1371647 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGTTTCTCGAAAGGATATATTGGGAAGATGGTCTAAGATTAGACAGAGATATTTTAGATCAATCAAATT
TGTCTATTTTAGAAAGGTCAAAGTCTGCAAGTTATTTGCCAGCAAATCTTAATAAAGGTATTCTTAGTTT
CGATTTAGATATAGAGAGTTTGCAGACGGGACTTATTATAATAAAAGATCTTGTATTGTACTTAGATGAA
AAAACATTTATTTTTTATGATAAATGCTATCCTCTATCTTTGCAGATAGTGACAGATGAGTTAACTAATG
ATATCCCTCTATTCTTGAATGTTAATGAGAAGATAGTTGAAAAAGAAGGTGTTAAGTACATACATAATCA
ACTATCACTTTCATTAGAGCATGATTATAGTGTTAAGTATAGTACGCAAATTGCATTATTTAAGTTAGAT
AGAGGTAAGTTAGTATCAGATACATATGATTTTCCTTTACTAACTCTTAATCACTATTCGATGCATGATA
TTTTTATAAAGCTCAATAGAATAGTTTCTGAATTAAAATCTTTCAATCGTTTTGTTTTCTCAACCTCAAG
ATCATATGCTGCAATTTTACTTGTATTCTTAATTAATAAATTAGAAAGAGAACTTAAATTTGCTGAATCT
AATAAGTTAAATGGTTCTCCTAAACAAATATTTGATCTAGTTCATGATATTTATAGTTTAATCCAGCTTA
ACTTAGATAAGGTTGAGGATGTTGATAATATTGAGTTTGATTTTTATAAACCTATAAGGAAGATAAACTT
ATTGGCTCATAGATTATTGACTCTTTGTGAATATAGAAAAATTAATAACTTTATTAAATTTGAACTGCAA
GGAAAAAAATATTTATGTGAAAACTTCCCCGAAGAATTTTTCGTTGCTACTAGATATTATATTTTCATTA
AAAGAAAGGCAACAGTTCCAGCTAATGTAAAATTTGAAAATAAAAAAGCTATGAGAATAACAAGTATAAG
TAGAAATAAAAACGTTGTAACTCTCTCTCTTTCTGGAGTGAAACTCGTTGAAGTTGAGCACTCTATGATG
AATTTTACAACACGGGTTGATAATATTGATGCAATATATGAAATTCAAAAAGGCTCGGAATGGGACTTTA
TACTTGCAGATAGTAGTGCGGTTTTTACAGCTTTTGAAGGTAGTGAAAACTTTGGTTTCTTTATAGCATT
TACCTAA