SecReT6
Protein ID: 565642702
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07605
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1372867..1373496 [-]
Productintracellular growth locus protein C
NoteIglC
UniProt IDV5VYV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 2.00E-131, Aligned region: 1..209
Protein Sequence: 209 a.a.     [Download]
>gi|565642702|ref|YP_008893548.1| intracellular growth locus protein C [Francisella noatunensis subsp. orientalis LADL--07-285A]
MNEMITRQQVTSGETINVRTDPTACIGSHPNRRLFVDSFTIGGVNLDKNIVAIEGGEDVTKADSATAAAS
VIRLSITPGSINPTISITLGALIKSSVRTLLEGAVSNILQAGATDMKIKLGNSNKKQEYKTDEAWGIMID
ISNLELYPISSDAFSIKIEPTELMGVSKDGMRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIASA
 
Nucleotide Sequence: 630 bp     [Download]
>gi|565641727|ref|NC_023029.1|:c1373496-1372867 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGAATGAAATGATAACAAGACAGCAAGTAACAAGTGGTGAAACTATTAATGTTAGGACTGATCCTACAG
CATGTATAGGATCTCATCCAAACCGTAGATTATTTGTAGACTCGTTTACTATAGGAGGAGTTAATCTTGA
TAAGAATATTGTTGCTATAGAAGGAGGAGAGGATGTTACAAAAGCTGATTCTGCAACTGCTGCAGCCAGT
GTTATACGTCTATCTATAACTCCAGGTTCTATAAATCCAACAATAAGTATTACACTTGGAGCTTTAATTA
AATCAAGTGTTAGGACCTTGCTTGAAGGAGCTGTTTCTAATATATTACAAGCGGGTGCAACAGATATGAA
AATTAAGCTTGGGAACTCTAATAAAAAGCAAGAGTATAAAACTGATGAAGCTTGGGGTATCATGATTGAT
ATATCTAATCTAGAGTTATATCCTATCAGTTCTGACGCATTTAGTATAAAAATAGAACCAACAGAGCTTA
TGGGCGTATCTAAGGATGGTATGAGATATCATATAATATCTATTGATGGGCTCACAACTTCACAAGGTAG
CTTGCCTGTATGCTGTGCTGCAAGTACTGATAAAGGAGTTGCTAAAATAGGGTACATAGCATCTGCATAG