SecReT6
Protein ID: 565642703
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07610
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1373514..1375034 [-]
Productintracellular growth locus protein B
NoteIglB
UniProt IDV5VYP4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.20E-141, Aligned region: 73..497
Protein Sequence: 506 a.a.     [Download]
>gi|565642703|ref|YP_008893549.1| intracellular growth locus protein B [Francisella noatunensis subsp. orientalis LADL--07-285A]
MLENSLSLTDELLNNFGGSAEVDSVLKNIDFDVSGDASKVLSLSSDYNARNLMALSLVLANNESINNYNQ
KYIQKVITVIDKLIDLQVNAIISNDEFRSLEQEWLKVQEVCQDDYDNVEVSILDVKKEELQYDFERNLYD
ISSSDFFKKVYVSEFDQYGGEPYGAILGLYSFENTTNDIIWLTGMGMVAKNSHASFIASIDKSFFGVKDL
SEITHIKSFESLLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYESN
DSYLWGPSSIQLVKNMMRSYDKTRWFQYIRGVESGGYVRNLVSCVYDNKGVLETKSPLNVLFADYMELSL
ANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDNFDSANSMLIANLSYTMCISRISHYIKCVIRDKIGSV
VGAEQIQNILSDWISEFVTTVYQPTPLEMARYPFRNVSIDVKTIPGKPGWYSCKINVIPHIQFEGMGTTM
TIDTRLEPKLFGANNN
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|565641727|ref|NC_023029.1|:c1375034-1373514 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGTTAGAAAATAGTTTAAGTCTTACAGATGAACTTTTAAATAATTTCGGTGGTTCAGCTGAGGTTGATA
GCGTACTTAAAAATATAGATTTTGATGTTTCGGGCGATGCATCTAAAGTTCTTTCTTTATCTTCAGATTA
TAATGCTAGAAACCTTATGGCATTATCTCTTGTGTTAGCAAATAATGAAAGTATAAATAATTATAACCAA
AAGTATATCCAGAAAGTTATTACTGTAATTGATAAACTTATTGATTTACAAGTTAACGCTATTATATCAA
ATGATGAGTTTAGATCTCTTGAGCAAGAATGGTTGAAGGTACAAGAGGTTTGTCAAGATGATTATGATAA
TGTAGAAGTAAGTATATTAGACGTTAAGAAAGAAGAGTTACAGTATGACTTTGAGAGAAATCTATATGAC
ATATCTAGTAGCGATTTCTTTAAGAAAGTATATGTCTCAGAATTTGATCAATATGGTGGTGAACCATATG
GTGCAATACTAGGACTCTATAGTTTTGAGAACACTACAAATGATATAATTTGGTTAACCGGGATGGGCAT
GGTGGCAAAAAACTCTCATGCATCTTTTATAGCATCAATTGACAAGTCATTTTTTGGTGTTAAAGATTTA
TCAGAAATAACTCATATAAAGAGTTTCGAGTCTTTATTAGAACACCCTAGATATAAAGAATGGAATGATT
TTAGGAATCTTGATGTTGCCGCATATATCGGTTTGACTGTCGGAGATTTTATGTTACGTCAGCCATATAA
TCCTGAAAATAATCCAGTTCAGTATAAGCTCATGGAAGGCTTTAATGAATTTGTTGATTATGAGAGTAAT
GATAGTTATTTGTGGGGCCCTTCATCTATTCAGCTAGTTAAAAATATGATGAGATCGTATGATAAAACTA
GATGGTTTCAATACATAAGAGGTGTTGAAAGTGGTGGTTATGTAAGAAACTTAGTGTCATGTGTTTATGA
TAATAAAGGTGTCTTAGAAACAAAGTCGCCACTGAATGTTTTATTTGCAGATTATATGGAGCTATCACTT
GCAAATATTGGTTTAATACCATTTGTGAGTGAAAAAGGTACAAGTAATGCTTGTTTCTTTAGTGTGAACT
CAGCTAAGAAAGTCGAAGAGTTTGTAGATAATTTTGATTCTGCTAACTCAATGCTAATTGCTAATCTTTC
TTATACTATGTGTATATCCAGAATTTCACATTATATTAAGTGTGTTATCAGAGATAAAATAGGAAGTGTT
GTTGGTGCTGAGCAAATTCAAAATATTCTTTCAGATTGGATATCAGAGTTTGTTACTACGGTATATCAAC
CAACACCCTTAGAGATGGCGAGATACCCTTTTAGGAATGTTTCTATTGATGTTAAAACTATACCAGGTAA
ACCAGGGTGGTATTCATGCAAAATAAATGTGATCCCTCACATTCAATTTGAAGGTATGGGTACTACAATG
ACTATTGATACTAGGTTAGAACCAAAATTATTCGGTGCGAATAATAACTAA