SecReT6
Protein ID: 565642704
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07615
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1375068..1375610 [-]
Productintracellular growth locus protein A
NoteIglA
UniProt IDV5VZ72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-41, Aligned region: 4..156
Protein Sequence: 180 a.a.     [Download]
>gi|565642704|ref|YP_008893550.1| intracellular growth locus protein A [Francisella noatunensis subsp. orientalis LADL--07-285A]
MAKNKIPNSRLMINYETNVDGVLKKKELPYRALVVGDLSKGRSVDAKKEFTDRAVRRVNNGVDRALEDMN
ISFDFEAPNFVSKDPGNLKVNYRIQSVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTID
MIFSDNNELEALKSKIPALTNYTIKDSDNAEVAESQESNN
 
Nucleotide Sequence: 543 bp     [Download]
>gi|565641727|ref|NC_023029.1|:c1375610-1375068 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGGCAAAAAATAAGATTCCAAATTCAAGATTGATGATAAATTATGAAACTAATGTGGATGGAGTTCTAA
AGAAAAAAGAATTACCTTACAGAGCTTTAGTAGTTGGTGATTTGTCGAAAGGAAGATCGGTAGATGCTAA
AAAAGAGTTTACTGATAGAGCTGTTAGACGAGTAAATAATGGTGTTGATAGAGCCTTAGAAGATATGAAT
ATATCTTTTGATTTTGAAGCACCAAATTTCGTCTCTAAAGACCCTGGCAATTTAAAAGTTAATTATAGAA
TTCAAAGTGTAAAAGATTTTAGGCCTGATGCTGTTGCTAAGAAAGTTCCTGAGATTAGAGCCTTGCTTGA
AATGAAAGAAATATTAGCATCTTTTGCTAAGGATATTGAAAATAATCGTAATCTTAAAAAGACTATAGAT
ATGATTTTTTCAGATAATAATGAGCTAGAAGCTTTAAAGAGTAAGATTCCTGCTTTAACAAACTATACGA
TTAAAGATTCTGATAATGCAGAAGTTGCAGAGTCGCAAGAGTCAAATAATTAA