SecReT6
Protein ID: 565642705
SecReT6 ID882
T6SS typeii
Gene symbol-
Locus tagM973_07620
StrainFrancisella noatunensis subsp. orientalis LADL--07-285A
Repliconchromosome [GenBank: NC_023029] [Browse all T6SS(s) in this replicon]
Location [Strand]1375678..1379448 [-]
ProductPathogenicity determinant protein D
NotePdpD
UniProt IDV5VYZ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1256 a.a.     [Download]
>gi|565642705|ref|YP_008893551.1| Pathogenicity determinant protein D [Francisella noatunensis subsp. orientalis LADL--07-285A]
MTKIDVLLFGVYMAEDINDILYDTDDLKKEKVDGGFFDFIKAWFYNDIERHMFFEDEIIVAQKLKTIDVM
ANTYAVERKKYFEKFLKDSHKQKGIFARIKDRDFAFYKDPTRVKLWSSITDTEVYNFFIKSSVNQMLGGG
NVAQLTSLPKFKFNAKLTASINSKNASAAASLVAAGEKSFMGSSCINIWSNLPIFDSERGNVKSFIPLYL
RMSGKASSAMFSYNVDIDANTSKLNFTDSKSLELLDNFKGNVNLKLVTAKGSKEAKSFVYIPKFKEDYKL
LNELGFILNTPDGSYRYLVPKIRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYEKQSLCIEKNGEGLM
TLAVSSKDYENPLIQVKTSTNTASFDLLSGEIKGKILADNLIGFANVKGSVNKFRNQVDSIIKKNIGESY
ESPFKIPNLSEFSDMEIKVRFGLYSKQSASKLRTLRISIPMTTKMLDFNQTSESYDMKSGMGYSMAQRND
LKGAIAYKQGLLESSAQRLLTGENLDLKNQLTSTAKDLTKDYVDFGNYAKNKVGSMMESVSTAAQQDFNL
AKTTGVRSYGSAQSILSSIYDKGGTFDSVIGSLSEIYKLKGSQLTNIDFNEILDVLSKNSSLANLSGKAG
VDFNELKSKFKDITSLDIKKKASEAILSTSQQQYNPSFNKAKTFSSPDSFYVQDTLINYSQTLKKEEFKD
QMSVINVVEFDDSSDLPILFNLCEMMTSESGKEEAKNFLSKKENAEKTKQFVESLENRATVISRESNISY
ASINVLCNKGAGSVITENNKASSVSLGSTVSLAEFNRIYALDSRVSRVGASPLEELSSFSTRKNKHKVTF
EEYFAKLTVQRYIEVMGVDDEADFIRSLVSPMMECQKKLLDNLVILNKEAKWKSSSSFKNVFSSSDNFSF
TGWLKDRLPGFDFELSQEYAYFTGLVINFSIEEDSSSSETVIKLCSITRSLDKLTRGFYLLLRRMAKNRN
SRVGSHDVSESHLNMVKQILTSLCEPYKNFTQKVEDTELLSALVNMLNFMDSFVEVQRLCASICVPSDSF
FALVNDNKDLLRDICYTVEKSGVTGIVFESTFSYSSELFGSNNQDMKLNIKSSSIKSSDGKVNEFTSIDR
DANTEAVLQNIYDNIAKLDEQDLDRLFRGFRILKQENSTNTDKTGFNIGLTYDPITNDVSVDVNKDNENL
YSYSNMSKDEYVKKIKNIVEAKVALNLGFEHEEVRSSQGFSVLATIPAKGYSIDDLNRVYRPMIWV
 
Nucleotide Sequence: 3771 bp     [Download]
>gi|565641727|ref|NC_023029.1|:c1379448-1375678 Francisella noatunensis subsp. orientalis LADL--07-285A, complete genome
ATGACAAAAATAGATGTTTTGTTGTTTGGGGTTTACATGGCTGAAGATATTAACGATATATTATATGATA
CTGATGATCTAAAGAAGGAAAAGGTTGATGGAGGTTTTTTTGATTTTATAAAAGCATGGTTTTATAATGA
CATTGAAAGGCATATGTTTTTTGAGGATGAGATTATTGTTGCTCAAAAATTAAAAACAATAGATGTAATG
GCTAACACTTATGCTGTAGAAAGAAAAAAATATTTTGAAAAATTTTTGAAGGACTCGCATAAACAAAAAG
GAATTTTTGCAAGAATTAAAGATAGAGATTTTGCTTTTTATAAAGATCCTACTAGAGTTAAACTGTGGAG
TAGTATTACTGATACGGAAGTTTACAATTTTTTTATAAAATCAAGTGTAAACCAGATGCTTGGTGGTGGA
AATGTAGCGCAATTAACTTCTCTACCAAAATTTAAGTTTAATGCCAAATTAACAGCATCTATTAATAGTA
AAAATGCTTCGGCTGCTGCGAGTCTTGTTGCTGCTGGTGAAAAAAGCTTTATGGGTAGTTCTTGTATAAA
TATCTGGTCTAATTTACCTATATTCGATAGTGAAAGAGGAAATGTTAAATCGTTTATACCTCTATATCTT
AGAATGAGTGGTAAAGCATCATCAGCAATGTTTAGCTACAATGTTGATATTGATGCAAATACAAGTAAGT
TGAACTTTACAGATTCGAAATCTCTGGAATTGCTAGACAATTTTAAAGGGAATGTAAATCTTAAACTAGT
AACAGCAAAAGGCTCAAAAGAAGCTAAGAGCTTTGTTTATATACCTAAATTTAAAGAAGACTATAAACTT
TTGAATGAATTGGGCTTTATTTTGAATACCCCTGATGGTTCATATAGATACTTAGTTCCTAAAATTAGAG
ATGGTCTTGATTTAATTAGAGAGTATACATATCCTGAGATTGAGCAGATTTATTTTGGTAGAAGTGCACT
CTCTGGTTATTCAAAAAGTAATTATGAAAAGCAGAGCCTATGTATTGAGAAAAATGGTGAAGGGCTCATG
ACTCTTGCGGTAAGCTCTAAAGATTATGAAAATCCATTAATTCAAGTAAAGACTTCTACTAACACTGCGA
GCTTTGATCTTTTATCTGGCGAAATAAAAGGTAAGATTTTAGCAGATAATTTAATAGGTTTTGCAAATGT
TAAAGGTTCTGTAAATAAGTTTAGAAATCAGGTTGATTCAATTATCAAAAAGAATATAGGTGAAAGTTAT
GAGTCACCTTTTAAGATACCAAACTTGTCTGAGTTTAGTGATATGGAGATTAAGGTAAGATTTGGACTAT
ATTCTAAACAGTCAGCATCTAAGCTTAGAACGCTAAGAATTTCTATACCTATGACTACCAAGATGTTGGA
TTTCAATCAAACATCTGAATCATATGATATGAAATCGGGGATGGGATATTCGATGGCTCAAAGAAATGAT
TTGAAAGGAGCTATTGCATATAAGCAAGGGTTATTAGAAAGCTCAGCACAGAGACTATTAACAGGTGAGA
ATTTAGATTTAAAGAATCAGTTGACATCAACAGCTAAAGATTTGACAAAAGACTACGTTGATTTTGGTAA
TTATGCAAAGAACAAGGTTGGCTCGATGATGGAGAGTGTTTCAACCGCGGCCCAACAAGACTTTAATCTT
GCTAAAACAACAGGAGTAAGGTCATATGGAAGCGCTCAAAGTATATTGTCTAGCATATATGATAAAGGGG
GTACTTTTGATTCGGTAATAGGGTCTCTAAGTGAAATATATAAGCTTAAAGGAAGTCAGTTAACTAATAT
TGATTTTAATGAAATTCTTGATGTATTGTCAAAAAATTCCTCTTTAGCTAATTTATCTGGGAAAGCTGGC
GTAGATTTTAATGAACTTAAATCAAAATTTAAAGATATTACATCTTTAGATATAAAGAAAAAAGCTTCTG
AGGCAATATTATCAACTAGTCAACAACAATATAATCCTAGTTTTAATAAAGCCAAAACATTTAGTAGCCC
GGATTCATTTTATGTCCAAGATACTCTGATTAACTACTCGCAGACTCTAAAAAAAGAAGAGTTTAAAGAT
CAGATGTCTGTAATAAATGTAGTAGAGTTCGATGATAGTAGTGACTTACCTATATTATTCAATCTTTGTG
AAATGATGACTAGTGAGTCAGGAAAGGAAGAAGCTAAAAATTTTCTTAGTAAAAAAGAAAATGCGGAAAA
AACAAAACAATTTGTTGAATCTTTAGAAAATAGAGCAACCGTAATAAGTCGAGAATCAAATATTAGTTAT
GCTTCAATAAATGTGTTGTGTAATAAAGGAGCTGGCTCTGTTATTACGGAAAATAATAAAGCATCCTCAG
TTTCTTTGGGTTCTACTGTGAGTTTGGCAGAATTTAATAGAATATACGCTCTTGATTCTAGAGTATCAAG
GGTTGGTGCTTCTCCCCTTGAAGAATTATCAAGCTTCTCAACTAGAAAAAATAAGCATAAAGTAACATTT
GAAGAGTACTTTGCAAAGCTTACAGTTCAGCGATATATTGAAGTTATGGGTGTGGATGATGAAGCTGATT
TTATCAGGTCACTTGTATCACCAATGATGGAGTGTCAAAAGAAATTGCTAGATAATCTAGTGATTTTGAA
TAAAGAAGCTAAATGGAAGAGTAGCTCGTCTTTTAAAAATGTATTCTCAAGTAGTGATAACTTCAGTTTT
ACTGGATGGTTGAAAGATAGACTTCCTGGTTTTGATTTCGAATTATCTCAGGAGTATGCATATTTTACAG
GTTTGGTAATCAATTTCTCTATTGAAGAAGATAGTTCATCATCTGAAACAGTAATTAAACTTTGTAGTAT
TACCAGATCTTTAGATAAGCTTACAAGAGGGTTCTATTTGCTATTGAGAAGAATGGCAAAAAACAGAAAC
TCAAGAGTTGGATCTCATGATGTTTCTGAAAGTCATCTTAATATGGTTAAGCAGATATTAACATCGTTAT
GTGAACCGTATAAAAACTTTACACAAAAGGTCGAAGATACAGAACTCTTGTCTGCATTAGTTAATATGTT
GAATTTTATGGATAGTTTTGTTGAGGTACAAAGACTATGTGCTTCAATATGTGTACCTAGTGATTCTTTC
TTTGCTTTAGTCAATGATAATAAAGACCTATTGAGAGATATTTGTTATACAGTTGAAAAAAGTGGAGTTA
CAGGAATTGTATTTGAATCAACTTTTAGCTATTCCTCAGAGCTTTTTGGCTCAAATAATCAAGATATGAA
ACTTAACATTAAGAGTTCTTCTATTAAATCTAGTGATGGTAAAGTAAATGAGTTTACTAGCATTGATAGA
GATGCTAATACTGAAGCAGTATTACAGAATATTTACGATAACATCGCTAAGCTTGATGAACAAGATTTAG
ACAGATTATTTAGAGGTTTTAGGATATTAAAACAGGAAAATTCAACAAATACTGATAAAACTGGTTTTAA
TATAGGATTAACATATGACCCAATAACTAATGATGTATCTGTTGATGTTAATAAAGACAATGAAAACTTG
TACTCGTATAGCAATATGAGTAAAGATGAATACGTTAAGAAAATTAAAAATATCGTAGAGGCAAAAGTGG
CGCTTAATCTTGGCTTTGAACATGAAGAAGTGAGAAGTTCGCAAGGATTTAGTGTTTTAGCAACAATACC
TGCTAAAGGATATTCTATTGATGATTTAAATAGAGTTTATAGACCAATGATTTGGGTTTAA