SecReT6
Protein ID: 565643501
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00044
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]27903..28409 [+]
Producthypothetical protein
NoteTssJ
UniProt IDV5TTX6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-32, Aligned region: 20..159
Protein Sequence: 168 a.a.     [Download]
>gi|565643501|ref|YP_008894797.1| hypothetical protein P262_00044 [Cronobacter sakazakii CMCC 45402]
MKNRTVLRQGFLAFLIAALTLLSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLKSDADFMSADF
FSLQNNAQTVLGANLLNSDEFFLMPGQLNKTLSGQSSLDARYIGVMAEYQALDGKKWRISLPLPAPSDSS
IYKFWKWSSDELEAKVFLDVNGIRVINE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|565643472|ref|NC_023032.1|:27903-28409 Cronobacter sakazakii CMCC 45402, complete genome
ATGAAAAACCGTACCGTTTTACGCCAGGGCTTCCTGGCGTTTTTGATTGCCGCTCTCACCTTACTGAGCG
GCTGCTTATCGTCTTCACGCAGCGTTCCTTCCCAGTACAGCCTGCATTTTCAGGCTCACCCGCAAATTAA
TAATTCCGCCCCGCTAAAAGTCCGGGTGCTGCTTTTGAAATCCGATGCCGACTTTATGTCTGCCGATTTC
TTTTCGCTGCAAAACAATGCGCAGACCGTGCTGGGAGCCAACCTGCTCAACAGCGACGAGTTCTTCCTGA
TGCCGGGCCAGCTGAACAAAACCCTCAGCGGCCAAAGCTCGCTTGACGCGCGCTATATCGGCGTGATGGC
GGAGTATCAGGCGCTCGACGGCAAAAAATGGCGAATTTCGCTCCCGCTTCCCGCCCCCAGTGACTCCAGC
ATTTATAAATTCTGGAAATGGTCATCCGACGAACTCGAGGCAAAAGTGTTTCTTGACGTCAATGGGATCC
GCGTCATCAACGAATAA