SecReT6
Protein ID: 565643502
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00045
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]28434..29777 [+]
Producthypothetical protein
NoteTssK
UniProt IDV5TTF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-143, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|565643502|ref|YP_008894798.1| hypothetical protein P262_00045 [Cronobacter sakazakii CMCC 45402]
MNKAEKVVWTEGMFLRPHHFQRAESFLQHHIREWGSLQRPYLWGFLDLEFDEAMLRQGRVALSYASGLLP
DGTPFSFRDARHGPAPLAIPDNLTHERVVLALPARRAGREEVIFSEAADSLARYATFEEEVEDDNALAVG
AATVQFGRLRLKLMLESELTAEWTAIGVAQVIEKRNDNQVRLDTSYIPPMLNAINSGPLYSMLNDLHGLL
GQRSQQISQRLRQPGRFNTSEMVEFMLLSLINHHLGHVTHLKTLPLLHPETLWRDWLAFACELTTWTAQR
APDATLPVYDHDNLAGCFGKLTLMLRQGLSLVMEESAIQLPLTERSHGLNVATVPESNMVREFGFVLAVK
ANVPGEALQTHFPAQMKVAPVTKIRDLVQLQLPGMVLRAMPVAPPQIPWHAGYSYFELEKGGELWKEMEK
SGAFALHLAGEFPGLDMEFWAIRSTNE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|565643472|ref|NC_023032.1|:28434-29777 Cronobacter sakazakii CMCC 45402, complete genome
ATGAACAAAGCAGAAAAAGTGGTCTGGACCGAAGGGATGTTCCTGCGTCCGCACCACTTCCAGCGCGCGG
AAAGTTTTCTGCAACACCACATCCGCGAATGGGGATCGTTGCAGCGTCCGTATCTCTGGGGATTTCTCGA
TCTGGAATTTGACGAGGCGATGCTGCGTCAGGGACGCGTGGCGCTGAGCTACGCCAGCGGCCTGCTGCCG
GACGGCACGCCGTTCTCTTTCCGCGACGCCCGCCACGGCCCGGCGCCGCTCGCCATTCCCGACAACCTCA
CGCACGAGCGCGTGGTGCTGGCGCTGCCTGCCCGCCGCGCCGGACGCGAAGAGGTGATTTTCAGCGAGGC
GGCCGATTCGCTCGCCCGCTACGCCACCTTTGAAGAAGAAGTGGAAGACGACAACGCGCTGGCGGTCGGC
GCGGCGACGGTGCAGTTTGGCCGCCTGCGTCTCAAGCTGATGCTGGAGAGCGAACTGACCGCCGAGTGGA
CGGCCATTGGCGTCGCGCAGGTGATTGAGAAGCGCAACGACAACCAGGTGCGCCTCGACACCAGCTACAT
TCCGCCGATGCTTAACGCCATCAACAGCGGGCCGCTCTACAGCATGCTCAACGATCTGCATGGCCTGCTC
GGCCAGCGCAGCCAGCAAATCAGCCAGCGTCTGCGCCAGCCGGGGCGGTTTAACACCTCGGAGATGGTGG
AATTCATGCTGCTGTCGCTGATTAATCATCATCTCGGCCACGTCACGCATTTAAAAACGCTGCCGTTGCT
CCACCCGGAAACCCTGTGGCGCGACTGGCTGGCGTTCGCCTGCGAACTCACTACCTGGACGGCGCAGCGC
GCGCCGGACGCCACGCTGCCGGTCTACGACCACGACAACCTGGCGGGCTGCTTTGGCAAACTGACGCTGA
TGCTGCGCCAGGGGCTGTCGCTGGTGATGGAAGAGAGCGCTATTCAGCTGCCGCTCACCGAGCGTTCGCA
CGGGCTTAACGTCGCCACCGTGCCGGAAAGCAACATGGTGCGCGAGTTCGGTTTCGTGCTGGCGGTCAAA
GCCAACGTGCCGGGCGAGGCGCTGCAAACGCACTTCCCGGCGCAGATGAAGGTCGCGCCGGTCACCAAAA
TTCGCGATCTGGTGCAACTGCAGTTGCCGGGTATGGTGCTGCGCGCCATGCCGGTTGCGCCGCCGCAGAT
CCCGTGGCATGCCGGCTACAGCTATTTCGAACTGGAAAAGGGCGGCGAACTCTGGAAAGAGATGGAGAAA
TCCGGCGCGTTCGCGCTGCATCTCGCTGGTGAATTCCCGGGCCTTGATATGGAGTTTTGGGCCATTCGCA
GTACGAATGAATAA