SecReT6
Protein ID: 565643506
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00051
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]35386..36408 [+]
Producthypothetical protein
NoteTssA
UniProt IDV5TTY1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 52..111
Protein Sequence: 340 a.a.     [Download]
>gi|565643506|ref|YP_008894802.1| hypothetical protein P262_00051 [Cronobacter sakazakii CMCC 45402]
MDIETLLAPVSPEQPCGDNLEYDADYQAMEQASQGKAEQQFGDTIIPAEPADWTKVEKLALSLLERTKDL
RVMLALTHAWAKRRGLPGYADGLLLIQEALTRYWEPLYPLLEEYGEKDPFYRINALAGLGDKSSLTSTLR
TATLLRSNGDEITLRDAQSLLDNSKSECPGYPGGRPRLVDELARGGQPGIEAIVQIHERLETIRTILVSH
LGESGVPEMEQLQKLTSIVALACQSGETQAPQEIPDPDVQAENAPAATTTSAPARVVETDWRNVQLQTRD
DAQLMLEKVKQYFARHEPSHPAPLMIERVQRLIEMNFMDLIRDLAPDSVHQVENIFGRRE
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|565643472|ref|NC_023032.1|:35386-36408 Cronobacter sakazakii CMCC 45402, complete genome
ATGGATATTGAAACCCTTCTCGCTCCGGTGAGCCCGGAGCAGCCGTGCGGCGACAACCTGGAGTACGACG
CCGATTACCAGGCGATGGAACAGGCAAGCCAGGGCAAGGCGGAACAGCAGTTCGGCGACACCATTATTCC
GGCAGAGCCGGCGGACTGGACTAAAGTTGAAAAGCTGGCTCTGTCGTTGCTTGAGCGCACCAAAGATCTG
CGCGTCATGCTGGCGCTGACCCACGCGTGGGCCAAACGCCGCGGCCTGCCGGGCTATGCCGACGGGCTGC
TGCTGATCCAGGAAGCGCTGACGCGCTACTGGGAGCCGCTTTATCCGCTGCTGGAAGAGTACGGCGAAAA
AGATCCGTTCTACCGTATTAACGCGCTGGCGGGGCTTGGCGATAAATCCTCCCTGACCAGCACGCTGCGC
ACCGCCACGCTGCTGCGCAGCAACGGCGACGAAATTACGCTGCGCGACGCGCAGTCGTTGCTCGACAACA
GCAAAAGCGAATGTCCGGGTTATCCGGGCGGCCGCCCGCGGCTGGTGGATGAACTCGCGCGCGGCGGCCA
GCCGGGCATCGAGGCGATAGTCCAGATCCACGAGCGACTGGAAACGATCCGCACCATTCTGGTCAGCCAT
CTCGGTGAGAGCGGCGTGCCGGAGATGGAACAGCTCCAGAAGCTGACGAGCATTGTGGCGCTGGCCTGCC
AGAGCGGCGAAACGCAGGCGCCGCAGGAGATACCAGACCCGGACGTGCAGGCGGAGAACGCGCCTGCCGC
CACGACGACCAGCGCCCCGGCGCGGGTGGTTGAAACCGACTGGCGCAACGTGCAACTGCAAACGCGCGAT
GACGCCCAGTTAATGCTTGAGAAAGTGAAGCAATATTTTGCCCGGCACGAGCCGAGCCACCCCGCGCCGC
TGATGATTGAGCGCGTGCAGCGACTGATTGAAATGAATTTCATGGATCTTATTCGCGACCTGGCGCCCGA
CAGCGTGCATCAGGTGGAAAACATTTTCGGACGCCGCGAGTAA