SecReT6
Protein ID: 565643507
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00052
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]36472..37008 [+]
Producthypothetical protein
NoteTssB
UniProt IDV5TTF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-60, Aligned region: 15..168
Protein Sequence: 178 a.a.     [Download]
>gi|565643507|ref|YP_008894803.1| hypothetical protein P262_00052 [Cronobacter sakazakii CMCC 45402]
MENIMPMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVFADLVGKPVDPQPAVDERKFLEID
IDNFDERMKALKPRVAFQVDNTLTGEGKLNIDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYM
DGKNGAEELIAKVLQDPTLLKSLSQMPKDDDGTKGNEE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|565643472|ref|NC_023032.1|:36472-37008 Cronobacter sakazakii CMCC 45402, complete genome
ATGGAGAACATCATGCCAATGAGTAACAGTGGGCAGAAATTTATCGCCCGTAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTGGAAATCTACGGTGCGGAACGCAAAATTCAGCTTCCGTTTGTGATGGGCGTGTT
TGCCGACCTGGTCGGGAAGCCGGTCGATCCGCAGCCTGCGGTGGACGAACGTAAATTCCTTGAAATTGAT
ATCGACAACTTCGACGAGCGTATGAAAGCGCTCAAGCCGCGCGTGGCGTTCCAGGTGGACAACACCCTGA
CCGGCGAAGGCAAACTGAACATCGATCTCACTTTCGACAGCATGGACGACTTCCTGCCGGACGCCGTCGC
GCGTAAGGTCGAGCCGCTGAACAAGCTGCTGGAAGCCCGTACTCAGCTCTCTAACCTGCTGACCTACATG
GACGGTAAAAACGGTGCCGAAGAGCTTATCGCGAAAGTGCTTCAGGACCCGACGCTGCTCAAATCGCTGA
GCCAGATGCCGAAAGATGACGATGGCACCAAAGGTAACGAGGAGTAA