SecReT6
Protein ID: 565643508
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00053
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]37012..38511 [+]
Producthypothetical protein
NoteTssC
UniProt IDV5TV02
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|565643508|ref|YP_008894804.1| hypothetical protein P262_00053 [Cronobacter sakazakii CMCC 45402]
MSNPSQQQELQSQQAFSQDEFSALLSKEFRPKTDQARSAVENAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEKLSQQVNQIIHHEEFQKLESAWRGLNYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEETDGANHSNYNWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLIHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|565643472|ref|NC_023032.1|:37012-38511 Cronobacter sakazakii CMCC 45402, complete genome
ATGAGCAATCCTTCTCAACAGCAAGAGCTGCAGTCGCAGCAGGCGTTCAGCCAGGATGAATTCAGCGCGC
TGCTCAGCAAAGAGTTTCGCCCGAAAACCGATCAGGCCCGTTCGGCCGTCGAAAACGCGGTAAAAACCCT
GGCCCAGCAGGCGCTGGAAAACACCGTGACCTTCTCGAACGACACCTACCGCACCATTCAGAACCTGATT
GCCGGTATCGACGAGAAACTGTCTCAGCAGGTTAACCAGATTATTCACCACGAGGAATTCCAGAAGCTGG
AAAGCGCCTGGCGTGGCCTGAACTATCTGGTCAACAACACGGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGCCGCACCCTGAAACGCTTTAAGGGCGTGGGCTGGGACCAGAGC
CCTATCTTCAAAAAAATCTACGAAGAAGAGTATGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGGTGG
GCGACTACTACTTCGACCACAGCCCGCAGGATGTTGAACTGCTGAGCGAAATGGCACGCATTGGCGCGGC
GGCGCACTGCCCGTTCATCACCGGCACCGCGCCAAGCGTGATGCAGATGGAATCCTGGCAGGAGCTGGCG
AATCCGCGCGACCTGACCAAAATCTTCCAGAACACCGAGTACGCTGCCTGGCGCAGCCTGCGCGAATCGG
AAGATGCGCGCTATCTGGGCCTCGTCATGCCGCGCTTCCTGTCGCGTCTGCCTTACGGCATCCGCACCAA
CCCGGTGGACAGCTTCGACTTCGAAGAAGAGACCGACGGCGCGAACCACAGCAACTACAACTGGGCTAAC
GCGGCCTACGCGATGGCGGCCAACATCAACCGTTCCTTTAAAGAGTACGGCTGGTGCACCTCCATTCGCG
GCGTGGAATCGGGCGGCGCGGTAGAAAACCTGCCGTGTCACACCTTCCCGAGCGATGACGGCGGCGTGGA
CATGAAGTGCCCGACCGAAATCGCCATCAGCGACCGTCGCGAAGCGGAGCTGGCGAAAAACGGCTTTATG
CCGCTGATCCACCGCAAAAACTCCGACTTCGCCGCCTTTATCGGCGCGCAGTCGCTGCAAAAACCGGCGG
AGTACCACGACCCGGATGCCACCGCGAACGCCCGTCTGGCAGCCCGCCTGCCATACCTGTTCGCCTGCTG
CCGTTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCTTTCCGCGAGCGCGATGAAATG
GAACGCTGGCTGAACGACTGGGTGATGAACTACGTGGACGGCGACCCGGCGAACTCCTCTCAGGAAACCA
AATCCCGTAAGCCGCTGGCGGCAGCCGAGGTGCAGGTTCAGGAGATCGAGGACAACCCGGGCTACTATGC
CGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGCCTGACCGTTTCTCTGCGTCTGGTCTCCAAA
CTGCCGTCGCTGAAGAGCAACGAGGCGTAA