SecReT6
Protein ID: 565643514
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00064
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]41251..43182 [+]
Producthypothetical protein
NoteFha
UniProt IDV5TUN6
KEGG IDcsi:P262_00064
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.90E-08, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0035, Aligned region: 29..49
UreE_N [PF02814], Evalue: 0.0035, Aligned region: 78..99
Protein Sequence: 643 a.a.     [Download]
>gi|565643514|ref|YP_008894810.1| hypothetical protein P262_00064 [Cronobacter sakazakii CMCC 45402]
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGECRITNRGNVTR
VVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPNVAPQQPQAPQPAKPQQPPKA
DAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKTPEAQPFNPFNAPKEADRNPEDPLAHFQSGG
NEPLFGNESVNPDSLFKDDTPFDKDSIFNDVTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGS
TPAQSRSDDPLGLMMGGAVPLTPPDELNAGAAPLTPPPAAKQDAEPVKPAISPEKPQPEKPQPEMTTSPL
APNADDSIDLASLAGSPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVVRSTAQTPKGRLRIDP
VQSPTSQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQGTVALLSSRSI
LKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRDALIDLQAHQLGMIAGIRAII
AAMLQSFNPEQLEEEAKRDGAISRLALPASRKAALWDYFVRHYSDTAGEIEDDFHTLFGEAFLHAYDMEV
NQYKDSQSGSEEE
 
Nucleotide Sequence: 1932 bp     [Download]
>gi|565643472|ref|NC_023032.1|:41251-43182 Cronobacter sakazakii CMCC 45402, complete genome
ATGCGATTCACGATTACTACCAACAAGCCCGGCCACCAGCCTCCTCAGAGCAGCTGTGACTTCTACCCGC
CGGGCGGCACGATTGGCCGTGGTACGGATAACAATCTGGTACTGCCGGATAACGAAAGAACGATTTCCCG
CCTGCAGGCGATTGTCCATATCTCCGCGGACGGCGAGTGCCGCATTACCAACCGCGGCAACGTCACCCGC
GTGGTGCTGAATGATATTCCGCTGGAGCGCGGCCGCCAGGTGGAGTTACAGGACGGCGACGTGCTCGGCA
TTGACGATTACCGCATCCAGGTGAGCGATCTGGCGCTGAACGCGCAGCCGGTTATCGCGATGGCCGCGCC
GAAACCGAACGTCGCGCCGCAGCAGCCTCAGGCGCCGCAGCCTGCGAAACCGCAGCAGCCGCCGAAAGCC
GACGCGCAGGACAACGCGCCGACGGCGGTGCCGACCGAAATCTGGGACAGCCTGATGCAGGAGTTTTCTA
TCTCCGACAGCATCAGCCAGGGCCAGAGCCAGAGCGCGCGCCCGAAAACGCCGGAAGCGCAGCCTTTTAA
CCCGTTCAACGCCCCGAAAGAGGCGGATCGCAACCCGGAAGATCCGCTGGCGCACTTCCAGAGCGGCGGC
AACGAGCCGCTGTTCGGCAATGAAAGCGTCAACCCGGACAGCCTGTTCAAAGATGACACGCCGTTCGATA
AAGACAGCATTTTCAACGATGTGACGCCAACCACGCTGGTGCCGCCGTCTGATAACCGTCAGGCCGCGAA
ACCGCAGGCGCCGCATAAAGAGAATGAAGAAGAGCTCGATCCGCTGGCGCTGTTTGGCGGCGTGGGCTCC
ACGCCTGCGCAGAGCCGCAGCGACGATCCGCTTGGCCTGATGATGGGCGGCGCTGTGCCGCTGACGCCGC
CGGATGAGCTTAACGCAGGCGCTGCGCCATTAACGCCGCCGCCCGCCGCGAAGCAGGACGCTGAGCCGGT
TAAACCAGCAATTTCTCCCGAAAAACCACAGCCGGAAAAACCGCAGCCGGAGATGACGACCTCGCCGCTC
GCGCCAAACGCGGACGACTCAATCGATCTGGCGTCGCTCGCCGGTTCGCCGCTGTTCCCGGAAGAAGTGC
CGGAAGAGCCGGTGACGCGCGTGGAAGTTCAGCCGACGCCGCCGGAAGTCCAGGATTACGCGGGTATTAC
GCTGCCGACGCCGCAGGCGGTGGTGCGCAGCACCGCGCAGACGCCAAAAGGCCGCCTGCGCATCGACCCG
GTGCAGTCGCCAACCAGCCAGGGCGGCACGCCAACGGCGTCTAACGGCGACGTGCTGAACGGCGAGCTGC
TGGAAGCCTTGCTGGAAGGCATGGGTCTTGGCGAGCTGCAACCGACGCCGCAGTTTGACCGCGACAATAT
GCGCCAGCTCGGCCAGATGCTCAGCATGTTCTCGCAGGGCACCGTGGCGCTGCTCTCCTCGCGCTCGATT
CTCAAGCGCGGCGTGAAAGCCGATATGACGATGGTACTGGACGACGCCAACAACCCGTTCAAGCTGCTGC
CGTCAGGCAAAACCGTGCTGATGCAGATGTTCGGCACCCGTATGCCGGGCTTTATGCCGCCGAAAAAATC
GGTGCGCGACGCGCTTATCGATCTTCAGGCGCACCAGCTTGGGATGATCGCCGGTATCCGCGCCATCATC
GCCGCCATGCTGCAATCCTTTAATCCGGAGCAGCTCGAAGAAGAGGCGAAGCGCGACGGCGCTATCTCGC
GCCTGGCGCTGCCGGCGAGCCGCAAAGCCGCGCTGTGGGATTACTTTGTGCGTCATTACAGCGATACCGC
GGGTGAGATCGAGGACGATTTCCATACTCTGTTCGGCGAAGCCTTCCTGCACGCTTATGACATGGAAGTG
AATCAGTACAAAGACTCACAAAGCGGATCGGAAGAAGAATGA