SecReT6
Protein ID: 565643517
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00068
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]45022..45855 [+]
Producthypothetical protein
NoteTagJ
UniProt IDV5TTG5
KEGG IDcsi:P262_00068
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.90E-44, Aligned region: 146..268
Protein Sequence: 277 a.a.     [Download]
>gi|565643517|ref|YP_008894813.1| hypothetical protein P262_00068 [Cronobacter sakazakii CMCC 45402]
MNTLYQQLAGASVSDALSRLEADIKAQPGNADRRAAFVQFLCLNANWTRALTQLKSWAALAPQAQPTVTL
LQQAIEGEQQRAEVLAGRARPRMPGEQWPWLDLLLKALAETDPARASELRSEALEQAEANPGELTLAVGD
APGEPVRFDWLMDGDARLGPVCELIVNGNYFWVPFSAIASIRFQAPASVTDLVWRHAMVQLVDGTEQVCQ
IPARYPLETGAEDRFLLARTTEWQPLDAEGIHYLGAGQKVWLSGEQEFALLTLDMLAFGLPDDASHE
 
Nucleotide Sequence: 834 bp     [Download]
>gi|565643472|ref|NC_023032.1|:45022-45855 Cronobacter sakazakii CMCC 45402, complete genome
ATGAACACGCTGTATCAACAACTGGCTGGCGCGAGCGTCAGCGACGCGCTGAGCCGTCTTGAGGCCGATA
TCAAAGCCCAGCCGGGCAACGCCGATCGCCGCGCTGCGTTTGTGCAGTTTCTCTGCCTGAACGCCAACTG
GACCCGTGCGCTCACCCAGCTGAAAAGCTGGGCCGCGCTGGCACCGCAGGCGCAGCCGACCGTGACGCTG
CTGCAACAGGCCATCGAAGGCGAGCAGCAGCGCGCTGAAGTGCTGGCAGGCCGCGCGCGTCCGCGGATGC
CGGGCGAACAGTGGCCGTGGCTGGATCTGCTGCTGAAAGCGCTGGCGGAAACCGACCCGGCGCGCGCCAG
CGAGCTTCGCAGCGAGGCGCTGGAGCAGGCCGAGGCCAATCCGGGCGAACTGACGCTGGCGGTGGGCGAC
GCGCCCGGCGAGCCGGTGCGTTTTGACTGGCTGATGGATGGCGACGCGCGTCTGGGGCCAGTGTGCGAGC
TTATCGTTAACGGCAACTACTTCTGGGTGCCGTTCAGCGCTATCGCGTCGATTCGTTTCCAGGCTCCGGC
GAGCGTTACCGATCTGGTGTGGCGTCACGCGATGGTGCAGCTGGTGGACGGCACCGAACAGGTTTGCCAG
ATCCCGGCGCGTTACCCGCTGGAAACCGGCGCGGAAGACCGCTTCCTGCTGGCGCGCACCACCGAGTGGC
AGCCGCTGGACGCGGAAGGCATTCACTATCTAGGCGCGGGTCAGAAAGTCTGGCTGAGCGGCGAACAGGA
GTTCGCGCTGCTGACGCTGGATATGCTCGCTTTCGGGCTGCCGGACGACGCATCGCATGAATAA