SecReT6
Protein ID: 565643518
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00069
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]45848..46420 [+]
Producthypothetical protein
NoteTssE
UniProt IDV5TV11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 58..166
Protein Sequence: 190 a.a.     [Download]
>gi|565643518|ref|YP_008894814.1| hypothetical protein P262_00069 [Cronobacter sakazakii CMCC 45402]
MNKPYQDDDSGDLLRHGYRSRRNATTVSARDKMQPSLLDRLTDNAPDKRQEPANSNLVSHSALRRQVLRD
LQWLFNTINNEAQQDLSRVDHVRRSVFNFGVAPLAGKRMSEIEWGDIQQRLTEAILHFEPRILPQGLQVR
CVCDTKSLDLHNVLSIEIKGRLWCVPWPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|565643472|ref|NC_023032.1|:45848-46420 Cronobacter sakazakii CMCC 45402, complete genome
ATGAATAAACCGTATCAGGATGACGACAGCGGAGATCTGCTGCGCCATGGCTATCGTTCGCGCCGCAACG
CCACGACGGTCAGCGCGCGCGACAAAATGCAGCCGTCGCTGCTGGACCGTCTGACCGATAACGCGCCGGA
CAAACGTCAGGAGCCGGCGAACAGCAATCTCGTCTCGCACAGCGCGCTGCGTCGCCAGGTGCTGCGCGAT
TTGCAGTGGCTGTTCAACACCATTAACAACGAAGCGCAGCAGGATCTGAGCCGGGTGGACCACGTGCGCC
GCTCGGTCTTTAACTTCGGCGTGGCACCGCTCGCGGGCAAGCGGATGTCGGAAATTGAGTGGGGCGATAT
CCAGCAGCGGCTCACCGAGGCGATTTTGCACTTCGAGCCGCGCATTCTGCCGCAGGGGTTGCAGGTGCGC
TGCGTCTGCGACACCAAATCGCTCGACCTGCACAACGTATTATCGATTGAGATTAAAGGCCGCCTGTGGT
GTGTGCCCTGGCCGCTTGAGTTCCTGTTCCGCACCGATGTGGATCTGGAAAACGGCCATTTTGAGCTTAA
AGATGCGGGGTAA