SecReT6
Protein ID: 565643519
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00070
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]46423..48294 [+]
Producthypothetical protein
NoteTssF
UniProt IDV5TUP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.70E-209, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|565643519|ref|YP_008894815.1| hypothetical protein P262_00070 [Cronobacter sakazakii CMCC 45402]
MDSKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMLAPNYLAPTPSMAIAELHPDSAKGDLSNGFVVPRGTMMDSQLLKKNGVTCSYATAHDVRLLP
LHISQVELGGVPADAPLSQLGLSQRGAVSALRVRIACDGPVLLNHLDFDRLDFFLSGPDIQALQLLELLM
EHRVGIFCQTVGPKPSRVVLADDALRQEGFEADQALLPDDLRNFDGYRLLQEYFAFPARFQFLSLRGIGK
LLAQSGQANAFDIIILLDKTDTPLERVVDKSHLAMHCTPVINLFPKIAERQKLTEGLSEYHLVVDNIRPL
DYEIFSVSKIYASEDGQRDDQIFRPFWSTWSRDGGNYGAYFSMRREQRALSEHALRYGTRTGYVGSEAFV
SLVDASHAPWRDELRYITAEVMCTSRDLPLMLAQDMGQFVLPDSMPVRALTMRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDAEDGEGAAALRQLLGLYARLAEAPVARQIDGIRHCVLEPVHRRVPEPGPIVFARG
VGISMTVDEQAFSGSSPWLLGSVLERVFARLVSMNSFTEFTLKSQQRGEVGYWGPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|565643472|ref|NC_023032.1|:46423-48294 Cronobacter sakazakii CMCC 45402, complete genome
ATGGACAGTAAACTGCTCGAATACTATAACCGAGAGCTGGCGTATCTGCGCGAAATGGGCGCGGAGTTCG
CCGAACGCTACCCGAAAGTGGCGGGCAGGCTCGGTATGCGCGGGATTGAAGTCGCCGACCCGTACATCGA
GCGCCTGATGGAAGGCTTCGCCTTTCTCACCTCCCGCGTACAGCTCAAAATGGACGCCGAGTTTCCGCGC
TTCTCACAGCGCCTGCTGGAGATGCTCGCGCCGAATTATCTGGCCCCCACGCCGTCAATGGCGATAGCCG
AACTGCACCCGGACAGCGCCAAAGGGGATCTGAGCAACGGGTTTGTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGCTTCTGAAAAAGAACGGCGTCACCTGTAGCTACGCCACCGCCCATGACGTGCGCCTGCTGCCG
CTGCATATCAGCCAGGTGGAGTTAGGCGGCGTGCCGGCCGATGCGCCGTTAAGCCAGCTCGGTTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCGTGCGCATCGCGTGCGACGGCCCGGTGCTGCTCAACCATCTCGA
TTTCGATCGCCTCGATTTCTTCCTGAGCGGGCCGGATATCCAGGCGCTGCAACTGCTGGAGCTGCTGATG
GAGCACCGCGTCGGCATCTTCTGTCAGACCGTCGGCCCGAAACCGTCACGCGTGGTGCTCGCCGACGACG
CGCTGCGTCAGGAAGGCTTTGAGGCTGACCAGGCATTGTTGCCGGACGATCTGCGCAATTTCGACGGCTA
CCGCCTGTTGCAGGAATATTTCGCGTTCCCGGCGCGCTTCCAGTTTTTAAGCCTGCGCGGCATCGGCAAG
CTGCTGGCGCAGAGCGGGCAGGCGAACGCGTTCGATATCATCATCCTGCTCGATAAAACCGACACGCCGC
TGGAGCGCGTGGTGGATAAGAGCCATCTCGCGATGCACTGCACGCCGGTCATCAATTTGTTCCCGAAAAT
CGCCGAGCGCCAGAAGCTTACCGAAGGCTTAAGCGAATACCACCTGGTGGTGGATAACATTCGCCCGCTG
GATTACGAGATTTTCTCGGTCAGTAAAATTTACGCCAGCGAAGACGGCCAGCGCGACGACCAGATCTTCC
GCCCGTTCTGGAGCACCTGGAGCCGCGACGGCGGCAACTACGGCGCGTATTTCTCAATGCGCCGCGAACA
GCGCGCGCTCTCGGAACACGCGCTGCGCTACGGCACGCGTACCGGCTATGTCGGCTCCGAGGCGTTTGTA
TCGCTGGTGGACGCAAGCCACGCGCCGTGGCGCGACGAACTGCGCTATATCACCGCCGAAGTGATGTGCA
CCAGCCGGGATCTGCCGCTGATGCTGGCGCAGGATATGGGCCAGTTCGTGCTGCCGGATTCCATGCCGGT
GCGCGCGCTCACCATGCGCAAAGGGCCGACGCCGCCGCGCCCGGCGCTGGCCGAAGGCTTCAGCACCTGG
CGGCTTATCAGCCAGCTGCAAATGAACTACTTAAGCCTGATGGACGCTGAAGATGGCGAGGGCGCCGCCG
CGCTGCGCCAGCTGCTCGGCCTCTACGCGCGCCTGGCGGAAGCGCCGGTGGCGCGCCAGATTGACGGCAT
TCGCCACTGCGTGCTGGAGCCGGTGCATCGCCGCGTGCCGGAGCCGGGCCCGATTGTCTTCGCCCGCGGC
GTCGGGATTTCGATGACCGTCGACGAACAGGCGTTTTCCGGCTCCAGCCCGTGGCTGCTCGGCAGCGTGC
TGGAGCGCGTCTTCGCACGCCTGGTCTCCATGAACAGCTTCACCGAGTTCACGCTCAAGAGCCAGCAGCG
CGGCGAAGTGGGCTACTGGGGGCCGCGAATGGGTAAAAGGGCGCTGATATGA