SecReT6
Protein ID: 565643522
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00077
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]49773..52388 [+]
Producthypothetical protein
NoteTssH
UniProt IDV5TTH1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-41, Aligned region: 222..245
AAA_2 [PF07724], Evalue: 2.00E-41, Aligned region: 602..767
AAA [PF00004], Evalue: 5.90E-22, Aligned region: 223..355
AAA [PF00004], Evalue: 5.90E-22, Aligned region: 608..692
ClpB_D2-small [PF10431], Evalue: 2.40E-15, Aligned region: 775..850
AAA_5 [PF07728], Evalue: 2.10E-14, Aligned region: 223..256
AAA_5 [PF07728], Evalue: 2.10E-14, Aligned region: 494..526
AAA_5 [PF07728], Evalue: 2.10E-14, Aligned region: 607..726
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 34..65
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 200..245
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 268..301
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 604..652
AAA_22 [PF13401], Evalue: 4.10E-08, Aligned region: 223..304
AAA_22 [PF13401], Evalue: 4.10E-08, Aligned region: 369..389
AAA_22 [PF13401], Evalue: 4.10E-08, Aligned region: 606..638
AAA_22 [PF13401], Evalue: 4.10E-08, Aligned region: 668..690
Sigma54_activat [PF00158], Evalue: 8.10E-08, Aligned region: 205..303
Sigma54_activat [PF00158], Evalue: 8.10E-08, Aligned region: 607..723
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 223..304
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 329..389
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 606..717
AAA_18 [PF13238], Evalue: 4.20E-06, Aligned region: 223..246
AAA_18 [PF13238], Evalue: 4.20E-06, Aligned region: 609..636
AAA_18 [PF13238], Evalue: 4.20E-06, Aligned region: 797..857
AAA_19 [PF13245], Evalue: 8.60E-06, Aligned region: 222..249
AAA_19 [PF13245], Evalue: 8.60E-06, Aligned region: 605..629
IstB_IS21 [PF01695], Evalue: 9.20E-06, Aligned region: 209..243
IstB_IS21 [PF01695], Evalue: 9.20E-06, Aligned region: 607..635
AAA_17 [PF13207], Evalue: 1.00E-05, Aligned region: 223..272
AAA_17 [PF13207], Evalue: 1.00E-05, Aligned region: 454..488
AAA_17 [PF13207], Evalue: 1.00E-05, Aligned region: 607..643
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 222..244
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 601..657
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 223..250
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 282..324
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 608..639
FtsK_SpoIIIE [PF01580], Evalue: 8.70E-05, Aligned region: 208..266
FtsK_SpoIIIE [PF01580], Evalue: 8.70E-05, Aligned region: 449..509
FtsK_SpoIIIE [PF01580], Evalue: 8.70E-05, Aligned region: 607..629
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 222..247
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 276..320
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 469..507
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 597..632
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 201..240
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 276..307
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 354..397
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 606..646
Clp_N [PF02861], Evalue: 0.00019, Aligned region: 26..75
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 605..632
RNA_helicase [PF00910], Evalue: 0.00088, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.00088, Aligned region: 608..629
RNA_helicase [PF00910], Evalue: 0.00088, Aligned region: 705..726
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 222..244
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 606..643
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 221..242
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 280..303
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 574..628
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 676..700
Hpr_kinase_C [PF07475], Evalue: 0.0065, Aligned region: 223..239
Hpr_kinase_C [PF07475], Evalue: 0.0065, Aligned region: 605..625
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 223..245
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 274..303
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 607..643
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 760..792
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 210..242
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 606..627
NTPase_1 [PF03266], Evalue: 0.0089, Aligned region: 223..245
NTPase_1 [PF03266], Evalue: 0.0089, Aligned region: 280..300
NTPase_1 [PF03266], Evalue: 0.0089, Aligned region: 607..630
Protein Sequence: 871 a.a.     [Download]
>gi|565643522|ref|YP_008894818.1| hypothetical protein P262_00077 [Cronobacter sakazakii CMCC 45402]
MSEISRAVLFGKLDTLLFTSLESATSFCKLRGNPYVELAHWLHQLMQQQDGDLQHLIRHFSLDEEALSRD
IVAALDRLPRGASSVSDLSEHIDSAVERAWVYGSLKFGVTRIRGGHLLIGILKTFNLANVLKGISSQFNR
ISADLLVEQFDAIFAGSKEAQQAVAAAPDAAGNAPVQQGTLAQYGQDLTARAREGKIDPVVGRDEEIRQM
VDILMRRRQNNPLLTGEAGVGKTAVVEGLAHRIAAGDVPEPLQNVQLWLLDIGMLQAGAGMKGEFEARLQ
GLINEVQSSATPIVLFIDEIHTLIGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALT
RRFQTVQVHEPDEEKAVLMLRSTVSPLEKHHRVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACAR
VAVSQSAPPPQLEDCLHRIAALEVEAEIAEREARVAVGDGERVARLNAEREALEAERDALTARWEEERAL
VDAIIALRAELHMADEEAQPALRETLAERQKALAAVQGDAPLLFAAVDANVVAAVVSDWTGIPLGRMVKN
EIDAVLKLADTLNQRVIGQRHGLELIAKRVRTSRARLDDPNKPVGVFMLCGPSGVGKTETALALAESLYG
GEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVF
DKGWMEDGEGRHIDFRNTIIILTSNVGTDLISAMCADPDLMPEPEALSAALRQPLLQVFPPALLGRLLVV
PYYPLSDAMLAEIVKLQLKRIQRRLEENHGIISEFDDSVITQIVARCTEVESGGRMVDAILTNTLLPQMS
QILLTASAQDEKYRRLRVTFEQGEFQCQFAA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|565643472|ref|NC_023032.1|:49773-52388 Cronobacter sakazakii CMCC 45402, complete genome
ATGTCAGAAATCAGCCGTGCCGTACTGTTCGGCAAACTGGATACGCTGTTGTTTACCTCGCTGGAAAGCG
CCACCTCCTTCTGCAAGCTGCGCGGCAACCCGTATGTGGAGCTGGCGCACTGGCTGCATCAGCTGATGCA
GCAGCAGGACGGGGATTTACAACATCTGATCCGCCATTTTTCACTGGATGAAGAGGCGCTGAGCCGGGAT
ATCGTGGCGGCGCTGGATCGCCTGCCGCGCGGCGCAAGTTCCGTTTCCGATCTCTCGGAGCATATCGACA
GCGCGGTGGAGCGCGCGTGGGTGTACGGCTCGCTGAAGTTCGGCGTGACGCGCATTCGCGGCGGGCATCT
GCTGATCGGCATTCTGAAAACCTTTAACCTGGCGAACGTGCTGAAAGGCATCTCCAGCCAGTTCAACCGC
ATCAGCGCCGACCTGCTGGTCGAGCAGTTCGACGCCATCTTCGCGGGCAGCAAAGAGGCCCAGCAGGCGG
TCGCCGCCGCGCCGGACGCCGCCGGCAACGCGCCGGTGCAGCAGGGCACGCTCGCGCAGTACGGCCAGGA
TCTCACCGCGCGCGCGCGTGAAGGCAAAATCGACCCGGTGGTCGGGCGCGATGAAGAGATCCGTCAGATG
GTGGATATTCTGATGCGTCGCCGTCAGAACAACCCGCTGCTGACCGGTGAAGCGGGCGTGGGTAAAACCG
CGGTCGTGGAAGGCCTCGCGCACCGTATCGCCGCGGGCGATGTCCCGGAGCCGCTGCAAAACGTGCAGCT
GTGGCTGCTCGATATCGGCATGTTGCAGGCGGGCGCGGGCATGAAAGGCGAATTTGAAGCGCGCTTGCAG
GGGCTTATCAATGAAGTGCAGTCCAGCGCCACGCCGATTGTGCTGTTTATCGATGAGATCCACACGCTTA
TCGGCGCGGGCGGCCAGCAGGGCACCGGCGACGCCGCCAACCTGCTGAAACCGGCGCTGGCGCGCGGCCA
GCTGCGCACCATCGGCGCGACCACCTGGGCGGAATATAAAAAATACATCGAGAAAGATCCGGCCCTGACG
CGCCGCTTCCAGACCGTGCAGGTGCATGAGCCGGATGAAGAAAAAGCCGTGCTGATGCTGCGCAGCACCG
TCTCGCCGCTGGAGAAACATCACCGCGTGCTGCTGCTGGACGAAGCGGTCAGCGCGGCGGTGAAGCTGTC
GCACCGCTACATTCCGGCGCGCCAGCTGCCGGATAAAGCCGTCGCGTTGCTGGATACCGCCTGCGCGCGC
GTCGCCGTCAGCCAGAGCGCGCCGCCGCCGCAGTTAGAAGATTGCCTGCACCGCATCGCGGCGCTGGAAG
TCGAAGCGGAAATCGCCGAGCGCGAAGCGCGCGTGGCGGTGGGCGACGGCGAGCGCGTGGCGCGTCTGAA
CGCCGAGCGTGAAGCGCTGGAAGCCGAACGCGACGCCCTGACCGCCCGCTGGGAAGAGGAGCGCGCGCTG
GTGGATGCGATTATCGCCCTGCGCGCCGAGCTGCATATGGCCGACGAAGAAGCCCAGCCTGCGCTGCGCG
AGACGCTGGCGGAGCGCCAGAAGGCGCTGGCCGCCGTACAGGGCGACGCGCCGCTGCTGTTCGCCGCGGT
GGACGCGAACGTCGTCGCGGCGGTGGTCTCCGACTGGACCGGCATCCCGCTGGGCCGCATGGTGAAAAAC
GAAATCGACGCGGTGCTGAAGCTTGCCGACACGCTGAACCAGCGCGTTATCGGCCAGCGTCATGGGCTTG
AGCTTATCGCCAAACGCGTGCGCACCTCCCGCGCGCGCCTTGATGACCCGAACAAGCCGGTGGGCGTCTT
TATGCTCTGCGGCCCGTCCGGCGTCGGTAAAACCGAAACCGCGCTGGCGCTCGCCGAGTCGCTGTACGGC
GGCGAGCAGAACGTTATCACCATCAACATGAGCGAGTTCCAGGAAGCGCATACCGTCTCCACGCTGAAAG
GCGCGCCTCCGGGCTACGTGGGCTACGGCGAAGGCGGCGTGCTGACCGAGGCGGTGCGTCGTCGTCCTTA
CAGCGTCGTGCTGCTCGATGAGATTGAAAAAGCGCACCCGGACGTGCATGAGATTTTCTTCCAGGTGTTC
GATAAAGGCTGGATGGAAGATGGTGAAGGGCGTCATATCGATTTCCGCAACACGATTATCATCCTGACGT
CCAACGTCGGCACCGATCTTATCAGCGCCATGTGCGCCGACCCGGACCTGATGCCGGAGCCGGAGGCGCT
CAGTGCGGCGCTGCGTCAGCCGCTTTTGCAGGTTTTTCCGCCTGCACTGCTGGGACGATTGCTGGTTGTG
CCGTATTATCCGTTAAGCGACGCGATGCTGGCCGAAATTGTGAAATTGCAGCTTAAGCGGATCCAGCGTC
GTCTTGAGGAAAATCACGGTATTATTTCCGAATTCGACGACAGCGTAATTACCCAGATTGTGGCGCGTTG
CACCGAGGTGGAATCCGGCGGCCGTATGGTCGATGCGATCCTTACCAACACCCTGCTGCCGCAGATGAGC
CAGATACTGCTCACCGCCAGCGCGCAGGACGAGAAATATCGCCGTCTGCGCGTGACGTTCGAGCAGGGTG
AGTTTCAGTGTCAGTTTGCGGCGTAA