SecReT6
Protein ID: 565643526
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00085
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]56342..58543 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDV5TTZ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-73, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 3.20E-24, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 0.0023, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.0023, Aligned region: 530..546
Gp5_C [PF06715], Evalue: 0.0023, Aligned region: 611..624
Protein Sequence: 733 a.a.     [Download]
>gi|565643526|ref|YP_008894822.1| Rhs element Vgr protein [Cronobacter sakazakii CMCC 45402]
MLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYLNGK
VTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSYRVW
EYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLILTDAPGQYEPFPGYETMPYHVTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQERWQ
VEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTVAHYRFEENRYASGPDSNTLHEIRFEVIPADV
PYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSGWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWELPGDATRMGFMTRSKDGHRDNASYLFFEDKMG
DELMDMHAEKNMNISVENDKTVTIDGSRTTTIGREQKDEVTGDASFHYGKTRTTTVKDFEKKTFENGEHI
TVQKGRTTNINSGRDRVNIMEGRTTTISKGGDVLHIESGGLKHTIDSGDLNVTISSGKWTQTITGGETLI
TSPQKITIHSDSEINLDTPYWVTNAHGHQESYVGISLGVTFFGLDIKMASVSFTPTSFGMTGIKMENNPV
TIHVDNGIKTRVAGCEFDSLAMSLHAAAVFMFI
 
Nucleotide Sequence: 2202 bp     [Download]
>gi|565643472|ref|NC_023032.1|:56342-58543 Cronobacter sakazakii CMCC 45402, complete genome
ATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGGCGCGAGG
CGCTGTCGGAGCCGTTTATGTTCACCCTGACGCTGCTCGGCACCGATGCGCGCGCCGACCGCAGCGCGCT
GCTGGGCCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACACCGCGCTACCTTAACGGCAAG
GTGACCCGCGTGGCGGTGAGCGCGGTGGAGCTTTCGGGCACCCGCTACGCGGCCTATGAGCTGACGGTGG
AGCCGGACCTCTGGCCGATGCAACGCGACCGCAACCTGCGTATCTTCCAGGGGCAGACGGTGCCGCAGAT
AGTGAAGACGCTGCTGGGCGAAAGCCGGGTGAACATGGAAGAGCGGCTTTCCGGCAGCTACCGCGTCTGG
GAATACTGCGTGCAGTACCAGGAGAGCAGCCTTGATTTCATCAGCCGCCTGCTGGAGCTGGAGGGCATCG
CCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTCATCCTCACCGATGCTCCCGGCCAGTACGAGCC
GTTCCCGGGCTACGAGACCATGCCGTATCACGTCACGCCGTCCGGTGGCAGCACAGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGCATCTACAGCCTCGACGACTACGACTTCCGCAAGC
CGAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGTTGTCGCCGCAGCCGGGGAGTATTGACGTCTACGA
CTGGCCGGGCCGCTTTGTGGAGCACGGCCACGGGGAGTTCTACGCCCGCATCCGCCAGGAGCGCTGGCAG
GTGGAGCACCGCCAGACCCAGGGCACCGCGACGGCGCTCGGCATCGCGCCGGGCCACACCTTTGTGCTGC
GCAACGCGCCGTTCTTCGGGGATAACGGCGAGTACCTGACTACCGTGGCGCATTATCGCTTCGAGGAGAA
CCGCTACGCGAGCGGCCCGGACAGCAACACCCTGCATGAAATTCGCTTCGAGGTGATACCGGCTGATGTG
CCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCAAAAGTGGTCGGCC
CGCAGGGCGAGAGTATCTGGACCGACAAATATGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGTCTCGG
CAAGGGCGACGACACCAGCTCCGGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTTCGGCGGC
GTGCAGATACCGCGCGTGGGCGACGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TTACCGGTCGCGTGTACAACGAGGCCAGCATGCCGCCGTGGGAATTACCCGGTGATGCCACGCGTATGGG
CTTTATGACCCGCAGTAAAGACGGGCACCGCGATAACGCCAGTTATCTTTTCTTTGAAGATAAAATGGGC
GATGAGTTAATGGATATGCATGCCGAGAAAAACATGAATATCTCGGTAGAAAACGACAAGACAGTCACGA
TTGACGGCAGTCGCACCACCACTATCGGACGTGAGCAAAAAGATGAAGTGACGGGTGATGCATCTTTCCA
TTATGGAAAAACGCGAACAACGACTGTGAAAGACTTCGAGAAAAAAACATTTGAAAATGGCGAGCATATA
ACAGTTCAAAAAGGTAGAACAACAAATATTAATAGCGGTCGTGATCGTGTTAATATAATGGAAGGCCGGA
CCACAACGATATCAAAAGGCGGTGATGTTTTACATATAGAGTCTGGTGGATTGAAACATACAATTGATTC
TGGAGATCTTAATGTAACTATATCTTCTGGAAAATGGACCCAGACAATTACAGGTGGTGAAACGTTAATT
ACATCACCGCAAAAAATAACTATTCATAGTGATTCAGAAATCAATCTTGACACCCCATACTGGGTAACAA
ACGCACATGGTCATCAAGAAAGTTATGTCGGGATTTCACTTGGTGTTACGTTTTTTGGATTAGACATTAA
AATGGCAAGTGTATCTTTTACCCCCACAAGCTTTGGGATGACAGGGATAAAAATGGAGAACAATCCTGTA
ACTATACATGTTGATAATGGAATAAAAACGCGCGTTGCCGGATGTGAATTTGATTCTTTGGCAATGAGTT
TGCATGCAGCTGCAGTCTTTATGTTTATTTAA