SecReT6
Protein ID: 565643544
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00114
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]80297..82237 [+]
Producthypothetical protein
NoteTssI
UniProt IDV5TUR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-73, Aligned region: 25..330
Phage_GPD [PF05954], Evalue: 1.80E-73, Aligned region: 516..555
Phage_base_V [PF04717], Evalue: 4.00E-24, Aligned region: 368..461
Protein Sequence: 646 a.a.     [Download]
>gi|565643544|ref|YP_008894840.1| hypothetical protein P262_00114 [Cronobacter sakazakii CMCC 45402]
MEVMFNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYL
NGKVTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSY
RVWEYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLILTDAPGQYEPFPGYETIPYHVTPSGGSTDE
EGVSQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQE
RWQVEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTVAHYRFEENRYASGPDSNTLHEIRFEVIP
ADVPYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNANALRFED
KAGEEQVWLQAERNLDTKVKKDETHSVGGSRILSVKQDYTGKVEGKQEHAIQMSRNELVGGQYDIKGQGT
VTVSSATGIRLVTGDSVLEMSANGEVNLYCTKFAINASGTGQINTGGTLDLNLKKEPDKASNVAPTPGDI
QNEVAKTFNSDGEGQA
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|565643472|ref|NC_023032.1|:80297-82237 Cronobacter sakazakii CMCC 45402, complete genome
ATGGAAGTTATGTTTAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCG
GGCGCGAGGCGCTGTCGGAGCCGTTCATGTTCACCCTGACGCTGCTCGGCACCGATGCCCGCGCCGACCG
CAGCGCGCTGCTGGGCCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACACCGCGCTACCTT
AACGGCAAGGTGACCCGCGTGGCGGTGAGCGCGGTGGAGCTTTCGGGCACCCGCTACGCGGCCTATGAGC
TGACGGTGGAGCCGGACCTCTGGCCGATGCAACGCGACCGCAACCTGCGTATCTTCCAGGGGCAGACGGT
GCCGCAGATAGTGAAGACGCTGCTGGGCGAAAGCCGGGTGAACATGGAAGAGCGGCTTTCCGGCAGCTAC
CGCGTCTGGGAATACTGCGTGCAGTACCAGGAGAGCAGCCTCGATTTCATCAGCCGCCTGCTGGAGCTGG
AGGGCATCGCCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTTATCCTCACCGATGCTCCCGGCCA
GTACGAGCCGTTCCCGGGCTACGAGACCATTCCGTACCATGTGACCCCTTCAGGCGGCAGCACAGACGAA
GAGGGCGTCAGCCAGTGGGCGCTGGAAGACAGCGTGACGCCGGGCATCTACAGCCTCGACGACTACGACT
TCCGCAAGCCGAACGCCTGGCTGTTCCAGGCGCGACAGAACCCGCTGTCGCCGCAGCCGGGCAGCATTGA
CGTTTACGACTGGCCGGGGCGCTTTGTGGAGCACGGCCACGGCGAGTTCTACGCCCGCATCCGCCAGGAG
CGCTGGCAGGTGGAGCACCGCCAGACGCAGGGCACCGCGACGGCGCTCGGTATCGCACCCGGCCACACCT
TTGTGCTGCGCAACGCGCCGTTCTTCGGGGATAACGGCGAGTACCTCACCACGGTGGCGCATTACCGCTT
CGAGGAGAACCGCTACGCCAGCGGCCCGGACAGCAACACCCTGCATGAAATCCGCTTCGAGGTGATACCG
GCTGATGTGCCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCAAAAG
TGGTCGGCCCGCAGGGCGAGAGTATCTGGACCGACAAATATGGCCGGGTGAAGGTGAAGTTCCACTGGGA
CCGCCTCGGCAAGGGCGACGACACCAGCTCCAGCTGGGTGCGCGTCTCCAGCGCCTGGGCAGGCCAGGGC
TTCGGTGGCGTACAGATACCGCGCGTGGGCGACGAGGTGGTGGTGGACTTCATCAACGGCGACCCGGACC
GCCCGCTGATTACCGGTCGCGTGTATAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCGGCGGCGGCGAC
GCAGATGGGCTTTTTAAGCCGCTCTAAGGACGGCTCGCCGGACAACGCCAACGCCCTGCGCTTTGAGGAC
AAAGCCGGCGAGGAGCAGGTGTGGCTCCAGGCCGAGCGCAACCTCGATACCAAAGTGAAAAAAGATGAAA
CCCACAGCGTCGGCGGCTCGCGGATACTTTCTGTTAAGCAGGACTACACCGGCAAAGTTGAAGGCAAGCA
GGAACACGCCATTCAAATGAGCCGCAATGAGCTGGTCGGCGGGCAGTACGACATCAAAGGCCAGGGCACG
GTGACCGTTTCTTCCGCGACCGGCATTCGCCTCGTCACGGGCGATTCGGTGCTGGAGATGAGCGCGAACG
GCGAGGTCAATCTCTACTGTACAAAATTCGCGATCAACGCCAGCGGCACAGGGCAAATCAATACCGGCGG
CACGCTCGATCTGAACCTCAAGAAGGAACCGGACAAAGCGTCAAACGTCGCGCCGACGCCCGGAGATATC
CAGAACGAAGTGGCAAAAACATTTAATTCCGACGGAGAGGGACAGGCATGA