SecReT6
Protein ID: 568128384
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3269
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3586629..3589322 [-]
ProductVgrG protein
NoteTssI
UniProt IDV9RV13
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-79, Aligned region: 42..354
Phage_GPD [PF05954], Evalue: 1.70E-79, Aligned region: 528..623
DUF2345 [PF10106], Evalue: 1.10E-33, Aligned region: 705..866
T6SS_Vgr [PF13296], Evalue: 6.60E-28, Aligned region: 564..668
Phage_base_V [PF04717], Evalue: 2.30E-19, Aligned region: 411..514
Protein Sequence: 897 a.a.     [Download]
>gi|568128384|ref|YP_008925031.1| VgrG protein [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MPQDSSGLSRLSTAGIAQANRLLDLRTPLGDNRLVAETLSATEQLSGGAYRLEITALSDDAHIPLKALMG
QPVTQRLQTALDREQPRLWHGHATAVRFLGANGGLARYGLTVEPWLAFLRARRDSFAYQDKTVIDIVDSI
FGDYKGQGALAPQWRWEVKDRAAYAKRSLAIQYRETDYAFVERLLAEEGLFYWVEHADDGHTLVIADHNG
AFKPGPQASVRFARADVTETEDSIQHWSPRQRWQTNAVRMASWDYRSAQARPVSAQADAGKLANAIELVS
DDYPGQYAYEDSAQGERLAHNALAALRVRQQSIEGAGTVRTLAPGQRFELTGHYQQGGASAFVVIAITHQ
ARNNFDADLGRAVSEALGGGDSDDADFYRNAFTCIGSDTEFRPATQDGHGVRLHPRPTVFGAQTALVIGA
EEPVHTDRDHRIKVQFHWQRGKASSSRMAHPSGEENAPAKDELGTWVRVAEPVAGGDWGGHFVPRVGQEV
LVEFLHGDIDRPVVVGALYNGEGAEDASHNKVQAGGANATGNAPAWFAGANEGHAHNAVMSGFKTQALAS
SGAGTGGYNQLVQDDTPGQSRLTASTTQADARLNLGHVKQQRDNERLQDLGHGAELSTKEAVALRGGSGL
LLSADLRENAEGPLLDSAEASKQIEAALEAARELADVAVRQKAILDGDPQALPAQEGLQHILEVVEATQD
DPNPQGAAVKVAAYSEPHIQVSAPSGIGQYTPANAFLVAGATFAQIAPDVNWASSAHLAVGVAGGALLFT
AGHAAGGGRPVKDAGLRLHAAGGKLRLHSQDARMTLSAEKAVTFASAGANVLVEGKQRVLATAAGAYLRL
EGGGIQLHAPGKVELKAGAHSWVGPQTASGNLAPPSGEFKDCPSKVNSAAAGGSAFV
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3589322-3586629 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGCCCCAGGATTCTTCCGGACTGTCCCGCCTGTCGACCGCCGGCATCGCGCAGGCCAACCGCCTGCTGG
ACCTGCGCACGCCGCTGGGCGATAACCGCCTGGTGGCCGAGACCCTGTCGGCCACCGAACAATTGAGCGG
CGGCGCCTATCGCCTGGAGATCACCGCGCTGTCCGACGACGCGCATATCCCGCTGAAGGCCCTGATGGGC
CAGCCCGTCACCCAGCGCCTGCAGACCGCGCTGGACCGCGAGCAGCCGCGCCTGTGGCACGGCCACGCCA
CGGCGGTGCGTTTCCTGGGCGCCAATGGCGGCCTGGCGCGCTATGGGCTGACCGTGGAGCCGTGGCTGGC
GTTCCTGCGGGCGCGGCGCGACAGCTTCGCCTACCAGGACAAGACGGTGATCGACATCGTCGACAGCATC
TTCGGCGACTACAAGGGCCAGGGGGCGCTGGCGCCGCAATGGCGCTGGGAAGTGAAGGACCGCGCCGCCT
ACGCCAAGCGCAGCCTGGCCATCCAGTACCGCGAAACCGACTACGCCTTCGTCGAGCGCCTGCTGGCCGA
AGAGGGCCTGTTCTACTGGGTCGAGCACGCCGACGACGGCCATACCCTGGTCATCGCCGACCACAACGGC
GCCTTCAAGCCCGGCCCGCAGGCCAGCGTGCGTTTCGCGCGCGCCGACGTCACCGAAACCGAAGACAGCA
TCCAGCACTGGAGTCCGCGCCAGCGCTGGCAGACCAACGCCGTGCGCATGGCCAGCTGGGACTACCGCAG
TGCCCAGGCGCGGCCGGTCTCGGCGCAGGCGGACGCCGGCAAGCTGGCCAACGCGATCGAGCTGGTCAGC
GACGACTATCCCGGCCAGTACGCCTACGAGGACAGCGCGCAGGGCGAGCGGCTGGCGCACAATGCGCTGG
CCGCGTTGCGCGTGCGCCAGCAGAGCATCGAAGGCGCGGGCACCGTGCGCACGCTGGCGCCGGGGCAGCG
TTTCGAGCTGACCGGCCACTACCAGCAGGGCGGCGCGTCCGCCTTCGTGGTGATCGCCATCACGCACCAG
GCCCGCAACAACTTCGACGCCGACCTCGGCCGTGCCGTGAGCGAGGCGTTGGGGGGCGGCGACAGCGACG
ACGCCGATTTCTATCGCAACGCCTTCACCTGCATCGGCAGCGACACCGAATTCCGCCCCGCGACGCAGGA
TGGCCATGGCGTGCGCCTGCACCCCCGTCCCACTGTGTTCGGCGCGCAGACCGCCCTGGTGATCGGCGCC
GAGGAACCGGTGCACACCGACCGCGATCACCGCATCAAGGTGCAGTTCCATTGGCAGCGCGGCAAGGCCT
CCAGCAGCCGGATGGCGCATCCTTCGGGGGAAGAGAACGCGCCCGCCAAGGATGAACTGGGCACCTGGGT
GCGCGTGGCCGAGCCCGTCGCCGGCGGCGACTGGGGCGGCCATTTCGTGCCGCGCGTGGGCCAGGAGGTG
CTGGTGGAATTCCTGCATGGCGACATCGACCGGCCGGTGGTGGTGGGCGCGCTCTACAACGGCGAGGGCG
CCGAGGATGCCTCGCACAACAAGGTGCAGGCGGGCGGCGCCAACGCCACTGGCAATGCGCCGGCCTGGTT
CGCCGGCGCCAACGAGGGCCACGCCCACAACGCGGTGATGTCCGGCTTCAAGACCCAGGCCCTGGCCAGC
AGCGGCGCCGGCACCGGCGGCTACAACCAGCTGGTGCAGGACGACACGCCGGGCCAGTCGCGCCTGACCG
CCTCGACCACCCAGGCCGATGCGCGCCTGAACCTGGGCCACGTCAAGCAGCAGCGCGACAACGAGCGGCT
GCAGGATCTGGGCCATGGCGCCGAGCTGTCGACCAAGGAGGCCGTGGCGCTGCGCGGCGGCTCGGGGCTG
CTGCTGAGCGCCGATCTGCGCGAGAACGCCGAAGGGCCGCTGCTCGACAGTGCCGAGGCCTCCAAGCAGA
TCGAGGCCGCGCTGGAAGCGGCCAGGGAACTGGCCGACGTCGCGGTCAGGCAGAAGGCCATCCTGGACGG
CGACCCGCAAGCGCTGCCGGCGCAAGAGGGCCTGCAACACATCCTGGAAGTGGTCGAGGCCACCCAGGAC
GATCCCAATCCCCAGGGAGCCGCCGTCAAGGTGGCGGCCTACAGCGAACCGCACATCCAGGTCAGCGCGC
CCAGCGGCATCGGCCAGTACACGCCGGCCAATGCCTTTCTGGTGGCCGGCGCCACCTTCGCGCAGATCGC
GCCGGACGTGAACTGGGCCAGCAGCGCGCACCTGGCGGTGGGCGTGGCGGGCGGCGCCTTGCTGTTCACG
GCCGGCCACGCGGCCGGCGGCGGCCGGCCGGTCAAGGACGCGGGCCTGCGCTTGCATGCGGCCGGGGGCA
AGCTGCGCCTGCACAGCCAGGACGCCAGGATGACCCTGAGCGCCGAAAAAGCCGTGACCTTCGCCTCCGC
CGGCGCCAACGTGCTGGTCGAGGGCAAGCAGCGCGTGCTGGCCACGGCCGCCGGCGCCTATCTGCGGCTG
GAGGGCGGCGGCATCCAGCTGCATGCGCCGGGCAAGGTCGAGTTGAAGGCCGGCGCGCACAGCTGGGTCG
GGCCGCAGACGGCCAGCGGCAACCTGGCCCCGCCCTCGGGTGAATTCAAGGATTGCCCAAGCAAGGTCAA
CAGCGCCGCGGCGGGAGGGTCGGCCTTTGTTTGA