SecReT6
Protein ID: 568128386
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3271
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3592043..3593134 [-]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDV9RV54
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-89, Aligned region: 15..344
Protein Sequence: 363 a.a.     [Download]
>gi|568128386|ref|YP_008925033.1| Uncharacterized protein ImpH/VasB [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MQRRRDPSVIESLLAEPQRFKFFQAVRVLELWFARQEGTRARNAVPAHLRFVNSSSLGFPASEIAGLTAF
DKNGQALHDADARLAALAAGTLGRVEIEPAFFGLLGGQGALPLHYSEILSHRESATRDRGARAFFDIFSN
RAAALFYAAWKKYRMPLRHETEQDHHYLPLLLALGGVGHPALRDRLHAGEGRVFDESLAHYAAAARQRPV
SAAYLQRVLADYFQVSLRVEQFVGRWYHVPPENRTQLGRPGAVLGVSAMAGERIWQRDLRIRLWIGPLSS
SAFADFLPGGARAQALEKLLTMFGGLSFEYEVRLVMAKEDVAGSALGGDAEGGGARLGWNSFLCTEPSAS
DRDDASYELHTIH
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3593134-3592043 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGCAACGGCGACGCGATCCTAGCGTAATCGAATCGCTGCTGGCCGAGCCGCAGCGCTTCAAGTTCTTCC
AGGCCGTGCGGGTGCTGGAACTGTGGTTCGCACGCCAGGAAGGCACGCGCGCCAGGAATGCCGTGCCGGC
GCACCTGCGCTTCGTCAACTCGTCGTCGCTGGGTTTTCCGGCCAGCGAGATCGCGGGGCTGACCGCCTTC
GACAAGAACGGCCAGGCCCTGCACGACGCCGACGCGCGACTGGCGGCGCTGGCCGCCGGCACGCTGGGAC
GGGTGGAGATCGAGCCGGCCTTCTTCGGCCTGCTGGGCGGGCAGGGCGCCTTGCCGCTGCATTACTCCGA
GATCCTGAGCCACCGCGAAAGCGCCACGCGCGACCGTGGCGCCCGCGCCTTCTTCGACATCTTCTCGAAC
CGGGCCGCGGCGCTGTTCTACGCGGCCTGGAAGAAGTACCGCATGCCGCTGCGGCACGAGACCGAACAGG
ACCATCACTACCTGCCGCTGCTGCTGGCGCTGGGCGGGGTAGGGCATCCGGCGCTGCGCGACCGCCTGCA
TGCCGGCGAGGGCCGCGTGTTCGACGAATCGCTGGCGCACTACGCGGCGGCGGCGCGGCAGCGGCCGGTG
TCGGCCGCGTACCTGCAGCGGGTGCTGGCCGACTATTTCCAGGTCAGCTTGCGGGTCGAACAGTTCGTCG
GCCGCTGGTACCACGTGCCGCCCGAAAACCGCACCCAGTTGGGCCGTCCCGGCGCGGTGCTGGGCGTGTC
CGCCATGGCGGGCGAGCGCATCTGGCAGCGCGACCTGCGCATCCGGCTGTGGATCGGCCCGCTGTCCAGT
TCGGCGTTCGCCGATTTCCTGCCCGGCGGCGCCCGCGCCCAGGCGCTGGAGAAACTGCTGACGATGTTCG
GCGGGCTCAGCTTCGAATACGAGGTGCGGCTGGTGATGGCCAAGGAGGACGTCGCCGGCAGCGCGCTGGG
CGGCGACGCCGAGGGCGGCGGCGCGCGCCTGGGCTGGAATTCCTTTCTTTGCACCGAACCGTCGGCGTCG
GATCGCGACGACGCCAGCTACGAACTGCACACCATCCACTGA