SecReT6
Protein ID: 568128387
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3272
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3593107..3594945 [-]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDV9RWX3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.80E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|568128387|ref|YP_008925034.1| Protein ImpG/VasA [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MEELLPYYERELGFLRGSSRDFAQRYPKIAARLGLSGETCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALFEVMYPHYLRPFPACSIAQFDMGGVAAQLTAPVRVARGTELKSHAVRGVACRFRTAYDVTLAPVAI
RQATFASTANAPSATQLPPGVTGRLSLTLACLAETQSFATLAVDRLRVYLHGEPSFVAALRDCLFLRTAA
AYIETQPGRWNRLPDVPLAQVGLAEDDALIDFPASSHPAYRLLAEYFVFSEKFNFVDIDLAALRRAVGPL
REFTLHLPVKGLRADSNTARLLESASADNFRLGCTPVINLFEQRADPIRVTHAAASYPVVADARRAYGYE
VYSIDRVRLVRQNAQGDSVVEFRPFYSLHHGETPEGASHYWTARRDSMVAERSPGYEMEMSIVDIDFNPA
LPQTETLSLELTCTNRDLPSHLAVGQPGGDLFLEGGSVAREIRMLRRPTHTHRFQQGRAAHWRLISHLAL
NHLSLVHSGLPALKETLRLYDLSHAAVAARQIEGLVGLDYKPATHWMPGEPFATFVRGIEIRLTINEENF
VGTSLHAFVAVLNRFFGLYVHANSFVQLVVLSRRGAEEILRCPPCNGDAILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3594945-3593107 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGGAAGAACTGCTGCCGTATTACGAACGCGAGCTGGGGTTCCTGCGCGGCTCGTCGCGGGATTTCGCCC
AGCGCTATCCGAAGATCGCCGCGCGCCTGGGGCTGTCGGGAGAGACCTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCATTCGCCCTGCTGGGCGCGCGCATCAACAAGAAGCTGGACGACGACTATCCGGAATTC
ACGGAAGCGTTGTTCGAAGTGATGTATCCGCATTACCTGCGGCCGTTTCCGGCGTGTTCGATCGCGCAGT
TCGACATGGGCGGGGTGGCGGCCCAACTGACCGCGCCGGTGCGCGTGGCGCGGGGCACCGAATTGAAATC
GCACGCCGTGCGCGGCGTGGCCTGCCGCTTCCGCACGGCCTACGACGTGACGCTGGCGCCGGTGGCCATC
CGCCAGGCCACGTTCGCCTCGACCGCCAACGCGCCATCGGCCACGCAACTGCCGCCGGGCGTGACCGGCC
GCCTGTCGCTGACGCTGGCCTGCCTGGCCGAAACGCAGAGCTTCGCCACCTTGGCCGTGGACCGCCTGCG
GGTCTATCTGCATGGCGAGCCGTCGTTCGTGGCAGCGCTGCGCGACTGCCTGTTCCTGCGCACCGCGGCG
GCCTACATCGAGACCCAACCCGGCCGCTGGAACCGGCTGCCGGACGTGCCGCTGGCCCAGGTGGGACTGG
CCGAGGACGACGCGCTGATCGATTTTCCGGCCAGCTCGCATCCGGCCTACCGGCTGCTGGCCGAGTACTT
CGTCTTTTCCGAAAAATTCAACTTCGTCGACATCGACCTGGCGGCGCTGCGGCGCGCGGTCGGGCCGCTG
CGCGAATTCACGCTGCACCTGCCGGTCAAGGGGCTGCGCGCCGATTCGAATACCGCGCGCCTGCTGGAAT
CGGCCTCGGCCGACAACTTCCGGCTGGGCTGCACGCCGGTGATCAACCTGTTCGAGCAGCGCGCCGATCC
CATCCGCGTCACGCATGCGGCGGCCTCCTACCCGGTGGTGGCCGATGCGCGCCGGGCCTACGGCTACGAG
GTCTATTCCATCGACCGCGTGCGGCTGGTGCGGCAGAACGCGCAGGGCGATTCGGTGGTGGAGTTCCGGC
CGTTCTATTCGCTGCACCACGGCGAGACGCCCGAGGGCGCCAGCCATTACTGGACCGCGCGGCGCGATTC
GATGGTGGCCGAGCGCAGCCCGGGCTACGAAATGGAGATGTCCATCGTCGACATCGACTTCAATCCGGCC
CTGCCGCAGACCGAAACGCTGAGCCTGGAGCTGACCTGCACCAATCGCGACCTGCCGTCGCACCTGGCGG
TGGGCCAGCCCGGCGGCGACCTGTTCCTGGAAGGCGGCTCGGTGGCGCGCGAGATCCGCATGCTGCGCCG
CCCGACCCATACGCACCGCTTCCAGCAGGGCCGCGCGGCGCACTGGCGCCTGATCTCGCACCTGGCGCTG
AACCACCTGTCGCTGGTGCACAGCGGCCTGCCGGCCTTGAAGGAAACCCTGCGCCTGTACGACCTGTCGC
ACGCGGCGGTGGCCGCGCGCCAGATCGAAGGGCTGGTGGGGCTGGACTACAAGCCCGCCACCCACTGGAT
GCCGGGCGAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCAATGAAGAAAACTTC
GTGGGCACCAGCCTGCATGCCTTCGTGGCGGTGCTCAACCGCTTCTTCGGCCTTTACGTGCACGCCAACA
GCTTCGTGCAGTTGGTGGTGCTGTCGCGCCGCGGCGCGGAAGAAATCCTACGGTGTCCCCCATGCAACGG
CGACGCGATCCTAGCGTAA