SecReT6
Protein ID: 568128388
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3273
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3594999..3595484 [-]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDV9RY72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-20, Aligned region: 29..135
Protein Sequence: 161 a.a.     [Download]
>gi|568128388|ref|YP_008925035.1| Uncharacterized protein ImpF [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MKGFEPSLFDKLFDGDGPAPHALRRLSVEEIKETVARDIEALLNTRMVFTEESLKRYPNCQRSILTYGLS
DFSGLSLASHYDREFICRSLEQAIARHEPRLTHVRVVLQVDSRATSVLYFAITAMLDVGPAHEPVTFDAT
LQPSTLQYSVSKGWAKAAAAA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3595484-3594999 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGAAGGGATTCGAACCCAGCCTGTTCGACAAGCTGTTCGACGGGGACGGCCCGGCGCCGCACGCGCTGC
GGCGCCTGTCCGTCGAGGAAATCAAGGAAACCGTCGCGCGCGACATCGAGGCCCTGCTCAATACCCGCAT
GGTCTTCACCGAGGAGTCGCTCAAGCGCTATCCGAACTGCCAGCGGTCGATCCTGACCTACGGGCTGTCG
GATTTCTCCGGGCTCAGCCTGGCCAGCCACTACGACCGGGAATTCATCTGCCGGTCGCTGGAGCAGGCCA
TCGCCCGCCACGAGCCGCGCTTGACGCACGTGCGCGTGGTGCTCCAGGTCGACAGCCGCGCCACCTCGGT
GCTGTATTTCGCGATCACCGCGATGCTGGACGTCGGCCCGGCCCATGAGCCGGTGACGTTCGACGCGACC
TTGCAGCCGTCGACGCTGCAGTATTCGGTCAGCAAGGGCTGGGCCAAGGCCGCGGCGGCCGCCTGA