SecReT6
Protein ID: 568128390
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3275
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3596099..3597589 [-]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDV9RY66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-189, Aligned region: 67..490
Protein Sequence: 496 a.a.     [Download]
>gi|568128390|ref|YP_008925037.1| Uncharacterized protein ImpC [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MSNSAAAQNAAAPAAADSGLLDQIVEQSRVAKSTAEHDRAKDLIGELAREVMKGTVVLSDNLSAMLDARV
AELDRLISAQLSEVMHGAEFQKLESTWRGLHYLCQESNTGPMLKIKVLNVTKRDLVRDFQTAIDFDQSLM
FKKVYEEEFGTFGGSPFGALLGNFEITRQPEDMYFIEQMSHVAAASHAPFIASASPELLGLDSFADLGRP
RDLAKVFDTVEYTKWRSFRDSEDSRYVGLTMPRFLGRLPYDPKEGTSVEGFNFVEDVDGTDHAKYLWCNA
AWAFGARLTAAFADFGWCAAIRGVEGGGLVENLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGLIP
LVHCKNSDYAAFFGAQSVQKAKKYNTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQSVE
SFLNRWVSQYVLLDDNANQEQKAQFPLREASVQVAEVPGRPGVFRAVAFLRPHFQLDELSISLRLVAELP
AQAQKS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3597589-3596099 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGAGTAATTCCGCCGCCGCGCAGAACGCGGCCGCCCCGGCCGCCGCCGACTCGGGCCTGCTCGACCAGA
TCGTCGAGCAGAGCCGGGTGGCCAAATCCACTGCCGAACACGATCGCGCCAAGGACCTGATCGGCGAACT
GGCGCGCGAAGTCATGAAGGGCACCGTGGTGCTGTCGGACAATCTGTCGGCCATGCTCGACGCCCGCGTG
GCTGAGCTGGACCGCCTGATCTCGGCCCAGCTCAGCGAAGTCATGCACGGCGCCGAGTTCCAGAAGCTCG
AAAGCACCTGGCGCGGCCTGCATTACCTGTGCCAGGAAAGCAATACCGGGCCGATGCTCAAGATCAAGGT
GCTCAACGTCACCAAGCGCGACCTGGTGCGCGACTTCCAGACCGCCATCGACTTCGACCAGAGCCTGATG
TTCAAGAAGGTCTACGAGGAAGAATTCGGCACCTTCGGCGGCTCGCCCTTTGGCGCGCTGCTGGGCAACT
TCGAGATCACCCGCCAGCCCGAGGACATGTACTTCATCGAGCAGATGTCGCACGTGGCCGCGGCCTCGCA
CGCGCCGTTCATCGCCTCGGCCTCGCCCGAGCTGCTGGGCCTGGACAGCTTCGCCGACCTGGGCCGCCCG
CGCGACCTGGCCAAGGTGTTCGACACGGTCGAATACACCAAGTGGCGCAGCTTCCGCGACTCCGAGGACT
CGCGCTACGTCGGCCTGACCATGCCGCGCTTCCTGGGCCGCCTGCCGTACGACCCGAAAGAGGGCACCTC
GGTGGAAGGCTTCAATTTCGTCGAGGACGTCGACGGCACCGACCATGCCAAGTACCTGTGGTGCAACGCC
GCCTGGGCCTTCGGCGCACGCCTGACCGCGGCCTTTGCCGACTTCGGCTGGTGCGCGGCGATCCGCGGCG
TCGAAGGCGGCGGCCTGGTCGAGAACCTGCCGACCCACACCTTCAAGACCGACGATGGCGAGATCGCGCT
CAAGTGTCCCACCGAAATCGCCATCACCGACCGGCGCGAGAAGGAACTGAGCGACCTGGGCCTGATCCCG
CTGGTGCACTGCAAGAACTCCGACTACGCGGCGTTCTTCGGCGCGCAATCGGTGCAGAAGGCCAAGAAGT
ACAACACCGACAGCGCCAATGCCAACGCGGTGCTGTCGGCGCAGTTGCAGTACATCTTTTCGGTGTCGCG
CGTGGCCCATTACCTGAAGGCCATGATGCGCGACAAGATCGGCAGTTTTGCGTCCGCGCAATCGGTCGAG
AGTTTCCTGAACCGCTGGGTCTCGCAGTACGTGCTGCTGGACGACAACGCGAACCAGGAGCAGAAAGCGC
AATTCCCCCTGCGGGAAGCATCGGTGCAGGTTGCCGAAGTGCCGGGTCGTCCTGGCGTGTTCCGGGCCGT
GGCGTTCCTGCGGCCGCATTTCCAACTCGACGAGCTGTCGATTTCCCTGCGTCTGGTGGCGGAACTGCCC
GCCCAGGCCCAGAAATCGTGA