SecReT6
Protein ID: 568128391
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3276
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3597582..3598046 [-]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDV9RV58
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-53, Aligned region: 2..146
Protein Sequence: 154 a.a.     [Download]
>gi|568128391|ref|YP_008925038.1| Uncharacterized protein ImpB [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MTYDVEKGDAIEQKELPFVVGVVGDFSAQSEAELPRLKDRKFVNIDVDNFDDVMRGLEPRAAYRVKNRLT
DEGGTFGVDLKFRSIEDFRPEAVVQQIEPLKELLEIRTKLADLRNKLAGNDKLEDLLGEVLSSTEKLQQL
TSEAGKDGKGGSNE
 
Nucleotide Sequence: 465 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3598046-3597582 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
TTGACCTATGACGTCGAGAAGGGCGACGCGATCGAGCAGAAGGAACTGCCCTTCGTCGTGGGTGTGGTGG
GCGACTTCAGCGCGCAGTCGGAAGCCGAGCTGCCGCGCCTGAAGGACCGCAAGTTCGTCAATATCGACGT
CGACAACTTCGACGACGTGATGCGCGGCCTCGAGCCGCGCGCCGCGTACCGCGTGAAGAACCGCCTGACC
GACGAGGGCGGCACCTTCGGCGTCGACCTGAAGTTCCGCTCGATCGAGGACTTCCGCCCCGAGGCCGTGG
TGCAGCAGATCGAACCGCTCAAGGAATTGCTGGAGATCCGCACCAAGTTGGCCGACCTGCGCAACAAGCT
GGCCGGCAACGACAAGCTGGAAGACCTGCTGGGCGAAGTGCTCAGCAGCACGGAAAAACTGCAGCAACTG
ACCAGCGAAGCCGGCAAGGACGGCAAGGGAGGCAGCAATGAGTAA