SecReT6
Protein ID: 568128394
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3279
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3599742..3601088 [+]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDV9RV24
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.30E-130, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|568128394|ref|YP_008925041.1| Uncharacterized protein ImpJ/VasE [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MSYSAKILWGEGLFLRPQHFQRQDAYHETRLAEMSRALHPYSWGLRAARFDAAALANGMLRATELSAIFP
DGEIYNAPHNDDLPPAVALDGLDGASEAVFYLALHPMKDIGGNYRDAQQAQGFDARYAHQDSPAPDLYTN
ASTAELAFLRKNVRLLSEHEPRDALLTIPVARVRRTASAGYELDTGFIAPSLTVQACGALFEQLRRLLDA
LQAKVNALYGFHREPNKNIIEFRSGDVASFWLLHTANEAYSALSHLFHNPQLHPERLFQEMLRLAGALMT
FSKVHTLADLPVYRHEQPGAAFAQLDTILRDLLDTVISTRYFSIVLEELRPSFHVGRLDSDKLDETTALY
LSVSAATPASELAETVPLRFKVGAPDDVEKLVLSAMPGVQLAYTPQVPPAVPVKPGACYFTLQTRGSLYD
RMLQARSIAIYAPSGIPELKLDLIAVTR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|568125122|ref|NC_023061.1|:3599742-3601088 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
GTGAGTTATTCAGCGAAGATCCTGTGGGGAGAGGGCCTGTTCCTGCGGCCCCAGCATTTTCAGCGCCAGG
ACGCCTACCATGAGACCCGCCTGGCGGAAATGAGCCGCGCGCTGCATCCGTATTCGTGGGGCCTGCGCGC
CGCGCGTTTCGACGCCGCCGCGCTCGCCAATGGCATGTTGCGCGCCACCGAACTGTCGGCGATCTTCCCC
GACGGCGAAATCTACAACGCGCCGCACAACGACGACCTGCCGCCCGCCGTGGCGCTGGACGGGCTGGACG
GCGCCAGCGAGGCCGTGTTCTACCTGGCCCTGCATCCGATGAAGGACATCGGCGGCAACTACCGCGACGC
GCAGCAGGCGCAGGGATTCGATGCCCGCTACGCGCACCAGGACAGCCCCGCTCCCGACCTCTACACCAAT
GCCAGCACCGCCGAGCTGGCGTTCCTGCGCAAGAACGTGCGGCTGCTGTCCGAACACGAGCCGCGCGATG
CGCTGCTGACGATCCCGGTGGCGCGCGTGCGCCGCACGGCCAGCGCCGGTTACGAGCTGGACACCGGCTT
CATCGCGCCCAGCCTCACGGTGCAGGCCTGCGGCGCGCTGTTCGAGCAGTTGCGCCGCCTGCTGGACGCG
CTGCAGGCCAAGGTCAATGCGCTGTACGGTTTCCATCGCGAGCCGAACAAGAACATCATCGAGTTCCGCT
CGGGCGACGTGGCCTCGTTCTGGCTGCTGCACACCGCCAACGAAGCCTATTCGGCGCTGTCGCACCTGTT
CCACAACCCGCAGCTGCATCCGGAACGCCTGTTCCAGGAGATGCTGCGGCTGGCCGGCGCGCTGATGACG
TTCTCTAAGGTGCACACGCTGGCCGACCTGCCGGTGTATCGCCACGAGCAACCCGGCGCGGCCTTCGCGC
AGCTCGACACGATCCTGCGCGACCTGCTCGACACCGTGATCTCGACGCGCTACTTCTCCATCGTGCTGGA
AGAGCTGCGCCCCTCGTTCCACGTGGGCCGCCTCGATTCCGACAAACTCGACGAGACCACCGCGCTGTAC
CTGTCGGTGTCCGCGGCGACGCCAGCCAGCGAGCTGGCCGAAACGGTGCCGCTGCGCTTCAAGGTCGGCG
CGCCGGACGATGTCGAGAAGCTGGTGCTGTCGGCCATGCCGGGCGTGCAACTGGCCTACACGCCACAGGT
GCCGCCGGCCGTGCCGGTCAAGCCGGGCGCCTGCTATTTCACCCTGCAGACGCGCGGCTCGCTGTACGAC
CGCATGCTGCAGGCGCGCAGCATTGCCATCTACGCGCCGTCCGGCATACCCGAGCTGAAACTGGACCTGA
TCGCCGTCACCCGCTGA