SecReT6
Protein ID: 568128401
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3286
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3611843..3614719 [-]
ProductVgrG protein
NoteTssI
UniProt IDV9RV69
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-52, Aligned region: 36..356
Phage_GPD [PF05954], Evalue: 7.90E-52, Aligned region: 452..501
Phage_GPD [PF05954], Evalue: 7.90E-52, Aligned region: 877..914
DUF2345 [PF10106], Evalue: 5.50E-38, Aligned region: 174..206
DUF2345 [PF10106], Evalue: 5.50E-38, Aligned region: 692..705
DUF2345 [PF10106], Evalue: 5.50E-38, Aligned region: 770..928
T6SS_Vgr [PF13296], Evalue: 1.20E-31, Aligned region: 603..708
Phage_base_V [PF04717], Evalue: 9.30E-18, Aligned region: 444..542
Phage_base_V [PF04717], Evalue: 9.30E-18, Aligned region: 779..794
Phage_base_V [PF04717], Evalue: 9.30E-18, Aligned region: 879..893
Protein Sequence: 958 a.a.     [Download]
>gi|568128401|ref|YP_008925048.1| VgrG protein [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MDPTANTGLFNSDARLYGLQGEGALASLQVEGWVAREALSGVGQWRVVALSDNAGLSLQDMISRPVTLWT
TRADGSRAGRSGVVREAELLSGDAGLARYRLTVVPWLWLATQRRASRVFEAKPVLDIVRHVLDGYEGYVY
RVAGDVEAALADLAPRPYTTQYRETDYDFIARLLAEAGLGWTVLEDAGVPARHVVQLFADSRGLAEDAES
AGGGIRFQRAAATESRDTVQMLARQRRRVPDSITVLGWHDSGKRAVAAQALVNPASGQDDAAGLDWYEVA
GHGGFADEAQARRQANLATEALRARAETFVGLGVVRTFRSGTRFTLRDLSPLGPAGEGGFEPEFALDRVE
HAGINNLPPETRASLAQRLGGLDAHLVLDGDALAAPGAEPHEAVSLRVDPAVLAKAREVGYANRFEAVRC
DRPWRPPLPSARGARLAGAPSVHGVHTAVVTDAEGGTQPKEQDEILRNKRGDVRIRFHWQGSGADGEARS
RWVRVAQRQSGAGMGISFVPRIGQEVLVRFLDDDIDQPIVVGALYNGRGEGGTPATPGGRQGAKADTQVY
AAARDGAPSAQANLASGNAPAWHGAAGGDENHRNAAALSGFKSKEFGGSGYNQIVFDDTDGQLRMQIKSS
EQASELNLGHLIHQAGNYRGGLRGLGAELRTDGYGAVRGGAGVLLSTYSATGANASAIGDAAGVQALAGQ
TDQMARSLDGVVGAHQGLRLATVQGTRGPGASVLDGDKAPLAAMHRAVSGTVAGESLGGARGDASAKHTA
AAQGKVPHATDPVVLMAARAGLAQVAGQHLQYTAGEAVHWSAGKDQNLAVMGALRLHTGQGLGIVAGLQQ
GGAESGLDLISAKGNVDIQAQHDILRVQAQQDLKIGSAQSAVEYAAPKRIRIATAAGASIVLEGGNITVT
APGRIDVKTGNKQFAGPDRLPYAFPQFTVCKQCVLDAQDGVQSITDKA
 
Nucleotide Sequence: 2877 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3614719-3611843 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGGATCCGACCGCGAACACCGGCCTGTTCAATTCCGATGCCCGCCTTTACGGCCTGCAGGGCGAGGGCG
CGCTCGCGTCGTTGCAGGTGGAAGGCTGGGTCGCGCGCGAAGCGCTCTCGGGCGTGGGGCAATGGCGCGT
GGTGGCGCTGTCCGACAACGCCGGCCTGTCCTTGCAGGACATGATCTCGCGGCCCGTCACGCTGTGGACC
ACCCGCGCCGACGGCAGCCGCGCCGGGCGCAGCGGCGTCGTCCGCGAAGCGGAATTGCTGTCCGGCGACG
CCGGCCTGGCGCGCTACCGGCTGACGGTGGTGCCATGGCTGTGGCTGGCCACGCAGCGGCGCGCCAGCCG
CGTGTTCGAGGCCAAGCCCGTGCTGGACATCGTGCGCCATGTGCTGGACGGCTACGAAGGGTATGTCTAC
CGCGTCGCCGGCGACGTGGAGGCGGCGCTGGCCGACCTGGCGCCGCGTCCCTACACCACGCAGTACCGCG
AGACCGACTACGACTTCATTGCCCGCCTGCTGGCCGAGGCCGGCCTGGGCTGGACCGTGCTGGAAGACGC
CGGCGTGCCGGCGCGCCACGTGGTGCAGTTGTTCGCCGACAGCCGCGGCCTGGCCGAAGACGCCGAGTCC
GCCGGCGGCGGCATCCGCTTCCAGCGGGCCGCCGCGACCGAGTCGCGCGACACCGTGCAGATGCTGGCGC
GCCAGCGCCGCCGCGTGCCCGACAGCATCACCGTGCTGGGCTGGCACGACAGCGGCAAGCGCGCGGTGGC
GGCGCAGGCGCTGGTCAATCCGGCCAGCGGCCAGGACGACGCCGCGGGGCTGGATTGGTACGAGGTCGCC
GGCCACGGTGGTTTCGCCGATGAAGCGCAGGCGCGGCGCCAGGCCAATCTGGCGACCGAAGCCCTGCGCG
CCCGGGCCGAGACCTTCGTCGGCCTGGGGGTGGTGCGCACCTTCCGTTCCGGCACGCGTTTTACGTTGCG
GGATCTGTCGCCGCTGGGGCCGGCCGGGGAAGGCGGCTTCGAACCGGAGTTCGCGCTCGATCGCGTCGAA
CACGCGGGCATCAACAACCTGCCGCCCGAGACGCGGGCCTCGCTGGCCCAGCGCCTGGGAGGGCTGGATG
CGCACCTGGTGCTGGACGGCGACGCGCTGGCCGCGCCGGGCGCCGAACCGCATGAAGCCGTGTCGCTGCG
CGTGGACCCGGCGGTGCTGGCCAAGGCGCGCGAGGTCGGCTATGCCAACCGTTTCGAGGCCGTGCGCTGC
GACCGCCCCTGGCGGCCGCCGTTGCCAAGCGCCCGCGGCGCGCGGTTGGCGGGCGCGCCCTCGGTGCACG
GCGTGCATACCGCCGTCGTGACGGATGCCGAAGGCGGCACCCAGCCGAAGGAGCAGGACGAGATCCTGCG
CAACAAGCGCGGCGACGTGCGCATCCGCTTCCATTGGCAAGGGAGCGGCGCCGATGGCGAAGCCCGCAGC
CGCTGGGTACGGGTGGCGCAGCGCCAGTCGGGCGCCGGCATGGGCATCAGTTTCGTGCCGCGCATCGGCC
AGGAAGTGCTGGTGCGTTTCCTGGACGACGACATCGACCAGCCCATCGTCGTGGGCGCGTTGTACAACGG
CCGCGGCGAAGGCGGCACGCCGGCCACGCCCGGCGGCCGCCAGGGCGCCAAGGCCGACACGCAGGTCTAC
GCCGCGGCCCGCGATGGCGCGCCCAGCGCGCAGGCCAACCTGGCGTCCGGCAATGCGCCGGCCTGGCATG
GCGCGGCCGGCGGCGACGAGAACCACCGCAACGCGGCCGCGTTGAGCGGCTTCAAGAGCAAGGAATTCGG
CGGCTCCGGCTACAACCAGATCGTGTTCGACGATACCGACGGCCAGCTGCGCATGCAGATCAAGAGCAGC
GAGCAGGCCAGCGAGCTGAACCTGGGCCACCTGATCCACCAGGCCGGCAACTATCGCGGCGGCCTGCGCG
GCCTGGGCGCGGAATTGCGCACCGACGGCTATGGCGCGGTGCGCGGCGGCGCCGGCGTGCTGCTGAGCAC
CTATAGCGCCACCGGCGCCAACGCCAGCGCCATCGGCGACGCCGCCGGGGTGCAGGCGCTGGCCGGCCAG
ACCGACCAGATGGCGCGTTCGCTCGATGGCGTGGTGGGCGCGCACCAGGGCCTGCGGCTGGCGACGGTGC
AGGGCACGCGCGGCCCCGGCGCCAGCGTGCTCGATGGCGACAAGGCGCCGTTGGCGGCGATGCACCGCGC
GGTCTCCGGCACCGTGGCGGGCGAGAGCCTGGGCGGGGCGCGCGGCGACGCGTCGGCCAAGCACACCGCC
GCGGCGCAGGGCAAGGTGCCGCATGCCACCGACCCGGTGGTGCTGATGGCGGCGCGCGCCGGCCTGGCGC
AGGTCGCCGGCCAGCATTTACAGTACACCGCCGGCGAGGCGGTGCACTGGTCCGCGGGCAAGGACCAGAA
CCTGGCGGTGATGGGCGCCTTGCGCCTGCATACCGGCCAGGGCCTGGGCATCGTGGCCGGCCTGCAGCAG
GGCGGCGCGGAATCGGGCCTGGACCTGATCTCGGCCAAGGGCAACGTCGACATCCAGGCGCAGCACGACA
TCCTGCGCGTGCAGGCGCAGCAGGACCTGAAGATCGGCAGCGCCCAGAGCGCGGTGGAGTATGCCGCGCC
CAAGCGCATCCGCATTGCCACGGCGGCGGGCGCCAGCATCGTGCTCGAAGGCGGCAACATCACCGTCACC
GCGCCGGGCCGCATCGACGTCAAGACCGGCAACAAGCAGTTCGCCGGACCGGACCGGCTGCCTTACGCCT
TCCCGCAATTCACCGTCTGCAAGCAGTGCGTGCTGGACGCGCAGGATGGCGTGCAGTCCATCACCGACAA
GGCGTGA