SecReT6
Protein ID: 568128407
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3292
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3622957..3623751 [+]
ProductOuter membrane protein
NoteTagL
UniProt IDV9RWX7
KEGG IDaxn:AX27061_3292
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.70E-24, Aligned region: 162..256
BON [PF04972], Evalue: 1.10E-06, Aligned region: 28..71
BON [PF04972], Evalue: 1.10E-06, Aligned region: 99..123
Protein Sequence: 264 a.a.     [Download]
>gi|568128407|ref|YP_008925054.1| Outer membrane protein [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MRVSLLIMAALFSCAAAAQDAATVVPANVIPQPGQVVASGAVPDEATKADVLARLQQVYGVGNVIDQIEV
GGVVAPPNWSEHVGKLIGQPLKQINRGQLEVDGTQIRLLGEVQNEASRQQIASTFATSLNPTYKIVNGLR
VAAGKDEQGLLDKVLTNRVVEFETGSATLTARGRELLDQVADVIPKLHSDKVQIIGHTDSSGSRSTNLAL
SQARADAVRAYLVDKGLPPGRFETLGAGPDQPVATNATAEGRAKNRRIEFRASR
 
Nucleotide Sequence: 795 bp     [Download]
>gi|568125122|ref|NC_023061.1|:3622957-3623751 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGCGCGTCTCTCTCCTGATCATGGCGGCGCTGTTCTCATGCGCCGCGGCGGCGCAGGACGCGGCCACCG
TCGTCCCCGCCAACGTCATTCCGCAGCCCGGCCAGGTCGTGGCCAGCGGCGCCGTGCCAGACGAGGCCAC
CAAGGCCGACGTGCTGGCCCGGCTGCAACAGGTCTACGGGGTGGGCAACGTCATCGACCAGATCGAGGTC
GGCGGCGTGGTGGCGCCGCCCAACTGGTCCGAACACGTGGGCAAGCTGATCGGCCAGCCGCTCAAGCAGA
TCAATCGCGGCCAGCTGGAAGTCGACGGCACCCAGATCCGCCTGCTCGGCGAAGTGCAGAACGAAGCCTC
GCGCCAGCAGATCGCCAGCACCTTCGCCACCTCGCTCAACCCGACCTACAAGATCGTCAACGGCCTGCGC
GTGGCCGCCGGCAAGGACGAACAAGGCCTGCTCGACAAGGTGCTGACCAACCGCGTGGTGGAATTCGAGA
CCGGCAGCGCCACGCTGACGGCGCGCGGACGCGAACTGCTCGACCAGGTGGCCGACGTCATCCCGAAGCT
GCACAGCGACAAGGTGCAGATCATCGGTCACACCGACAGCTCCGGCAGCCGCAGCACCAACCTGGCGCTG
AGCCAGGCGCGCGCCGACGCGGTCCGCGCCTATCTGGTGGACAAAGGCCTGCCGCCCGGACGTTTCGAGA
CGCTGGGCGCGGGCCCGGACCAGCCGGTGGCCACCAACGCCACCGCCGAGGGCCGCGCCAAGAACCGCCG
CATCGAATTCCGCGCCAGCCGCTAG