SecReT6
Protein ID: 568128408
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3293
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3623841..3624953 [-]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDV9RY91
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-25, Aligned region: 54..115
Protein Sequence: 370 a.a.     [Download]
>gi|568128408|ref|YP_008925055.1| Uncharacterized protein ImpA [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MSDIDALLQPIAGEAPCGADMVFSAEFDAIREARRHDDPHLDQGDWVIDIKEADWPQVIRICTEVLTERS
KDVRVAAWLAEAWAKTRGFAGLRDGFLLVDGLCRRYWDGLHPVPDEGDVQQRVGNLAWLLSRSQQLVREL
PLTQSEGGRFGAVLWDSATQLANAIKRAPQNAADLTRGKVTLDQFDAARRDTPPAFYSELESQLQGCFGA
VDVLERTLTERLGEEGPAFTPLRTALKDVTELAHRFAREAGLLVRADLAPPAAQATPPAGAAVTRMEPTL
TAVDLPSTAPLAATRGPLQTRDQALAQLREVAEFFRRTEPHSPVAYLADKAASWGEMSLHLWLRTVLKNN
DALSGLEELLGVPKAPENNG
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|568125122|ref|NC_023061.1|:c3624953-3623841 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGAGCGATATCGACGCACTGTTGCAGCCCATTGCGGGCGAGGCGCCTTGTGGCGCCGACATGGTCTTTT
CGGCCGAATTCGACGCCATCCGCGAGGCCCGCCGCCACGATGACCCGCACCTGGACCAGGGCGACTGGGT
CATCGACATCAAGGAGGCCGACTGGCCGCAGGTGATCCGCATCTGCACCGAGGTGCTGACCGAGCGCAGC
AAGGACGTGCGCGTGGCCGCCTGGCTGGCCGAAGCCTGGGCCAAGACGCGCGGCTTCGCCGGCCTGCGCG
ACGGCTTCCTGCTGGTGGACGGCCTGTGTCGGCGCTATTGGGACGGCCTGCACCCGGTGCCGGACGAGGG
CGACGTGCAGCAGCGCGTGGGCAACCTGGCGTGGCTGCTGTCGCGGTCGCAGCAGCTGGTGCGGGAACTG
CCCTTGACGCAGTCCGAGGGCGGGCGTTTCGGCGCGGTGCTGTGGGACAGCGCCACGCAATTGGCCAACG
CCATCAAGCGCGCGCCGCAGAACGCCGCCGACCTGACCCGCGGCAAGGTTACGCTCGACCAGTTCGACGC
CGCGCGCCGCGATACGCCGCCGGCGTTCTATTCCGAACTCGAAAGCCAGTTGCAGGGCTGCTTTGGCGCG
GTCGACGTGCTCGAGCGGACCTTGACCGAACGCCTGGGCGAGGAAGGCCCGGCTTTCACGCCGCTGCGCA
CCGCCCTGAAGGACGTGACCGAGCTGGCGCACCGCTTTGCCCGCGAGGCCGGCCTGCTGGTGCGGGCCGA
CCTGGCGCCGCCGGCCGCCCAGGCCACGCCGCCCGCCGGCGCGGCCGTCACCCGCATGGAGCCTACCTTG
ACCGCCGTCGACCTGCCTTCCACCGCGCCGCTGGCGGCCACGCGTGGCCCGCTGCAAACGCGCGACCAGG
CCCTGGCGCAGTTGCGCGAAGTGGCCGAGTTCTTCCGCCGCACCGAGCCGCACAGCCCGGTGGCCTACCT
GGCCGACAAGGCGGCCAGCTGGGGCGAGATGTCGCTGCACCTGTGGCTGCGCACGGTGCTCAAGAACAAC
GACGCCCTGTCCGGGCTGGAAGAGTTGCTGGGCGTTCCCAAGGCGCCCGAGAACAACGGCTGA