SecReT6
Protein ID: 568128410
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3295
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3625417..3626577 [+]
Producthypothetical protein
NotePAAR
UniProt IDV9RY83
KEGG IDaxn:AX27061_3295
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.60E-19, Aligned region: 8..80
Protein Sequence: 386 a.a.     [Download]
>gi|568128410|ref|YP_008925057.1| hypothetical protein AX27061_3295 [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MAQRSVIRKGDRTSHGGVVVTGDESVQIFGQPMARVGDRVTCPKCAGQHTIVEGVQSVSSDRRTALEGMK
TSCGATLIASQQFYQLEHGGGDGAGGGVNDAPQALQAGAPAALAAVVPVAADEAPQQCAQVQDTLKLTEA
MFDAKRAPVRLTGPSAYKPPAALARAGDDKLVMYEAWPAGQRVPVVLEPRKPLWTGDLLQRSPHEISERL
TEEPQPQPEQVAKSLGVAPKALLQGRDLQITIAKGMSVDDSVKRLDAQWVKGPPWADPTREVHTVGETMF
SRITLYSMPGEQAVIDHAVLHELAHSYANNARVDMKAWGAAAKSDGNFPSDYAKAGPPEDFAEFVVMAIA
TQGTPCENYARSIYPARYRQLDAMDLLEKSPAAQAA
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|568125122|ref|NC_023061.1|:3625417-3626577 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGGCGCAGCGATCCGTAATACGCAAGGGTGACCGCACCTCGCATGGCGGCGTGGTGGTCACCGGAGACG
AGTCCGTGCAGATCTTTGGCCAGCCCATGGCGCGCGTCGGCGACCGCGTCACCTGCCCCAAGTGCGCCGG
CCAGCACACCATCGTCGAAGGCGTGCAAAGCGTCAGTTCCGATCGCCGCACCGCGCTGGAAGGCATGAAG
ACCTCCTGCGGCGCCACCCTCATCGCCAGCCAGCAGTTCTACCAGTTGGAGCACGGCGGCGGCGATGGCG
CCGGTGGCGGCGTGAACGATGCGCCGCAGGCGCTGCAGGCCGGCGCGCCGGCGGCACTGGCCGCGGTGGT
GCCGGTGGCGGCCGACGAGGCGCCGCAGCAATGCGCCCAGGTCCAGGACACCCTCAAGCTCACCGAAGCC
ATGTTCGACGCCAAGCGCGCCCCGGTCAGGCTGACCGGACCGTCGGCCTACAAGCCGCCGGCCGCGCTGG
CGCGCGCGGGCGATGACAAACTGGTCATGTATGAAGCCTGGCCGGCCGGCCAGCGCGTGCCCGTGGTGCT
GGAACCGCGCAAGCCGCTGTGGACCGGCGACCTGCTGCAGCGCTCGCCCCACGAGATCAGCGAACGCCTG
ACCGAGGAACCGCAGCCGCAGCCCGAGCAGGTCGCCAAGAGCCTGGGCGTGGCGCCCAAGGCGCTGCTGC
AGGGGCGCGACCTGCAGATCACCATCGCCAAGGGCATGTCGGTGGACGACAGCGTCAAGCGGCTCGACGC
GCAATGGGTGAAAGGCCCGCCCTGGGCCGATCCCACCCGCGAGGTCCACACCGTGGGCGAGACGATGTTC
TCGCGCATCACGCTCTACAGCATGCCGGGCGAGCAGGCCGTGATCGACCACGCCGTGCTGCACGAGCTGG
CCCACAGCTACGCCAACAACGCCCGTGTCGACATGAAGGCCTGGGGCGCCGCGGCCAAATCGGATGGCAA
TTTCCCGTCGGACTACGCCAAGGCCGGCCCACCCGAGGATTTCGCCGAATTCGTGGTGATGGCCATCGCC
ACCCAGGGCACGCCTTGCGAGAACTACGCCCGCTCGATCTACCCGGCCCGTTACCGGCAGTTGGACGCGA
TGGACCTGCTGGAGAAAAGCCCCGCCGCCCAGGCCGCATGA