SecReT6
Protein ID: 568140719
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18880
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4156631..4157497 [-]
ProductOmpA family protein
NoteTssL
UniProt IDV9QZN5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-62, Aligned region: 61..265
Protein Sequence: 288 a.a.     [Download]
>gi|568140719|ref|YP_008933304.1| OmpA family protein [Pseudomonas sp. TKP]
MTTDREYPQDEKTVLLDREGRGPAQGAITDFPTPPRFEQLEDRMIYAARLQGAQTFNMGLNPLVAVAWEL
LAEVARLRSHCGRESLQTLNDRLSEGVTQFETRALHEGSENGQVMSARYVLCSVIDEAVVTTAWGSRSDW
SKVSLLSRFHNETFGGEKFFQLLERLSRDPVKHIALLELMYLCLAMGFEGKYRVMERGVLQLEAVRDALY
RQVRHVRGTPLPVSVLPPRVEPVRHKAPRKLPTLWVGILCLGCMLAIYSGFAWVLGKERTQVLQPFQISA
PDLTRTPL
 
Nucleotide Sequence: 867 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4157497-4156631 Pseudomonas sp. TKP, complete genome
ATGACCACGGACCGTGAATACCCACAGGACGAAAAAACTGTCCTGCTTGATCGTGAAGGACGGGGGCCGG
CGCAGGGCGCGATCACCGATTTCCCCACGCCACCGCGCTTCGAGCAATTGGAAGACCGAATGATCTACGC
GGCCCGCTTGCAGGGCGCGCAGACCTTCAATATGGGGCTTAACCCGCTGGTTGCGGTCGCTTGGGAATTA
CTGGCGGAGGTGGCCCGGCTCAGGAGCCATTGCGGTCGGGAAAGCTTGCAAACACTGAATGATCGGCTGT
CGGAAGGGGTCACCCAATTCGAGACCCGTGCCTTACATGAGGGGAGCGAAAACGGCCAGGTCATGTCGGC
GCGTTATGTGTTGTGCAGCGTGATCGACGAAGCGGTGGTGACCACCGCCTGGGGCAGTCGCAGCGACTGG
TCGAAGGTCAGCCTGCTGAGCCGCTTCCATAACGAAACGTTCGGCGGCGAAAAGTTTTTCCAGCTGCTGG
AGCGACTGTCCCGAGACCCGGTCAAGCACATTGCGCTGCTGGAATTGATGTACCTGTGCCTGGCGATGGG
GTTTGAGGGTAAATATCGGGTCATGGAGCGTGGCGTGCTGCAACTTGAAGCGGTGCGCGATGCCTTGTAT
CGCCAGGTCAGGCATGTCCGGGGCACGCCGCTGCCTGTCTCTGTATTACCGCCACGGGTGGAGCCCGTAC
GCCATAAAGCCCCGCGCAAGCTGCCGACCCTTTGGGTTGGAATCCTTTGCCTGGGCTGCATGCTGGCGAT
CTATTCGGGGTTTGCCTGGGTATTGGGCAAAGAGCGCACACAGGTGCTGCAACCTTTTCAAATTTCGGCG
CCGGATCTGACTCGGACGCCCCTGTAA