SecReT6
Protein ID: 568140720
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18885
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4157503..4158831 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDV9QXV2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-122, Aligned region: 18..441
Protein Sequence: 442 a.a.     [Download]
>gi|568140720|ref|YP_008933305.1| type VI secretion protein [Pseudomonas sp. TKP]
MLVHKVIWQEGMLLRPQHLQHNDRYYNQQLNRTRLLGCDTWGFITLEIDLQYLRLGKIVVNQASGVLPDG
SLFELSAAMEPLVLQVPANAGRQGIHLALPLTTHNQIEARKQDQADVWARYITWPMDVGDSNAGVDLRCQ
IHCGRPDLRLLLGEHHSDQACVMLKVAQVVDCTDEEGVSLDPEFSPTFMYVQGSAYVSSCLKEVISLLAC
RGDAIAERIQGNGAAAGSQIGDFLMLQLVNRCEWVLRHYLGQVQVRPETVFRECLSMLGELSTFAHDSKR
AQLDVRYRHNDQGASFRGLMEGIRSMLSMVLEQHAMELALQQRQYGVLVCPVSDLKLLGSATFILTASAQ
CDSDELRHRLPAHLKIGPVERIRELVNLHLAGIKVKPLPVAPRQLPFHAGKTYFMLELSARDITQLEHSG
GFAFHVGGEFAELELTFWAIRN
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4158831-4157503 Pseudomonas sp. TKP, complete genome
ATGCTCGTTCATAAAGTCATTTGGCAGGAAGGCATGTTGTTGCGGCCCCAGCACCTGCAACACAACGATC
GTTACTACAACCAGCAACTCAACCGCACCCGCCTGCTGGGCTGCGACACCTGGGGTTTCATCACCCTTGA
AATCGACCTGCAGTACCTGCGCCTGGGCAAGATCGTCGTCAACCAAGCCAGTGGTGTATTACCCGACGGC
AGCCTCTTCGAGTTGAGTGCCGCCATGGAGCCGCTGGTCCTGCAGGTACCTGCCAACGCGGGCAGGCAAG
GGATCCATCTTGCGTTGCCGTTGACGACCCACAACCAGATCGAGGCGCGCAAGCAGGACCAGGCCGATGT
CTGGGCACGCTATATCACCTGGCCGATGGACGTTGGCGACTCCAATGCCGGTGTCGATTTACGTTGTCAG
ATTCACTGCGGCCGTCCGGACCTGCGCCTGCTGCTGGGGGAGCATCACAGTGACCAGGCGTGTGTGATGC
TCAAGGTCGCCCAGGTTGTGGATTGCACGGATGAAGAGGGCGTGAGCCTGGACCCGGAGTTCAGCCCGAC
CTTCATGTATGTCCAGGGATCGGCTTATGTATCGTCGTGCCTCAAGGAGGTGATCAGCCTGCTGGCCTGC
CGAGGCGACGCCATTGCAGAGCGTATCCAGGGCAACGGTGCCGCCGCCGGTTCGCAGATCGGCGACTTTC
TGATGCTGCAACTGGTCAATCGTTGCGAGTGGGTCCTGCGTCACTATCTGGGCCAGGTTCAGGTTCGTCC
GGAAACGGTGTTCCGCGAGTGCCTGTCGATGCTCGGTGAGTTATCGACGTTCGCCCATGACAGCAAGCGT
GCCCAGTTGGACGTGCGGTATCGGCATAACGACCAGGGCGCCAGCTTTCGTGGGCTGATGGAGGGCATTC
GCTCCATGCTGTCGATGGTGCTGGAGCAGCATGCCATGGAGCTCGCGCTGCAACAGCGTCAATACGGCGT
GCTGGTATGCCCGGTGAGCGACCTCAAGCTGCTCGGCAGCGCGACCTTCATCCTGACGGCCAGCGCGCAG
TGTGATTCGGATGAGCTTCGTCACCGTTTGCCGGCGCATCTGAAGATCGGCCCGGTGGAGCGTATACGCG
AACTGGTCAACCTGCATCTGGCGGGCATCAAGGTCAAGCCGCTGCCGGTGGCGCCGCGCCAGTTGCCGTT
CCATGCCGGCAAAACCTATTTCATGCTCGAACTCAGCGCCCGGGACATCACGCAACTGGAGCATTCGGGT
GGGTTTGCCTTCCATGTCGGCGGCGAGTTTGCCGAGCTTGAACTCACCTTCTGGGCCATTAGGAACTGA