SecReT6
Protein ID: 568140721
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18890
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4158833..4159327 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDV9QZH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-37, Aligned region: 18..144
Protein Sequence: 164 a.a.     [Download]
>gi|568140721|ref|YP_008933306.1| type VI secretion protein [Pseudomonas sp. TKP]
MMIMYRAAVASMLVVFSLLTGCSTLSPFSTVTKLDLKLVASDQVNPDLHGRPSPIVVHLLELRHPVAFEN
ADFFSLYGRAEQAMPKDWVSSEELEMRPGERLELKLKVEPQSRYVGVLAAYRDLPHVQWRMVVSLNPQKL
TRASLVLDKAGIRVANPISGARQD
 
Nucleotide Sequence: 495 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4159327-4158833 Pseudomonas sp. TKP, complete genome
ATGATGATCATGTATCGAGCCGCCGTTGCATCCATGCTGGTGGTATTCAGCCTGTTGACCGGGTGCAGCA
CCCTGTCGCCTTTTTCTACCGTGACCAAGCTGGACCTGAAGCTGGTCGCCAGTGATCAGGTCAACCCCGA
CCTGCACGGGCGTCCCTCGCCGATCGTGGTGCACTTGCTCGAGCTGCGCCATCCCGTGGCCTTCGAGAAC
GCCGATTTTTTCAGCCTTTACGGGCGTGCCGAGCAAGCCATGCCCAAGGACTGGGTAAGCAGCGAGGAGC
TGGAAATGCGCCCCGGCGAACGGCTGGAGCTCAAGCTCAAGGTTGAACCGCAGAGCCGTTATGTGGGGGT
GCTGGCCGCCTATCGAGACCTGCCCCATGTGCAGTGGCGAATGGTGGTGTCGCTTAACCCGCAGAAACTG
ACCCGGGCCAGCCTGGTGCTTGACAAGGCTGGCATCCGGGTCGCCAACCCGATTTCTGGTGCGAGGCAGG
ATTGA