SecReT6
Protein ID: 568140722
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18895
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4159324..4160514 [-]
Productsignal peptide protein
NoteFha
UniProt IDV9QY82
KEGG IDpsk:U771_18895
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.40E-12, Aligned region: 29..97
Protein Sequence: 396 a.a.     [Download]
>gi|568140722|ref|YP_008933307.1| signal peptide protein [Pseudomonas sp. TKP]
MQLVFEVYDGAGTEPLAGARKTFAGVGGVIGRGAGCDWVIPDASRLLSSHHGLVSYREGRYFLTDISSNG
ICVADSGERLNKGQARLIADGDLFQLGALAIRARLIEPPAPPGARRFTAPGPIPDDAFLALDPMQALDDE
DLTHPSLDGLDALSTVAQEPGQWMTHSAADRDHLVLPRWVEPDLEEPPSPQVVTAPADNESFWTQFAAAL
GIRLDDVDRPAREALAIKVAGLLKLSIEGLQHNLRTCDELKSESNLAPAAPVVNSPNPLRQCADAETALA
ALLGISEFGQLPADLAITQVHRDMQTHQIALLAACRAAARSAREAFAPSYLLLCFERQDKSPRFNTDGAQ
WRAYQRHYQRLVEAEPLTGHLLGKDFARAYDEQVRLISTLHVDYPG
 
Nucleotide Sequence: 1191 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4160514-4159324 Pseudomonas sp. TKP, complete genome
ATGCAACTGGTATTTGAAGTGTATGACGGCGCTGGCACCGAGCCGCTGGCCGGCGCTCGCAAGACGTTTG
CCGGTGTCGGCGGTGTGATCGGTCGCGGGGCCGGTTGCGACTGGGTGATCCCCGATGCCAGTCGACTGTT
GTCCAGTCACCATGGGCTGGTGAGCTACCGTGAAGGTCGCTACTTTCTGACGGACATCAGCAGCAATGGC
ATTTGCGTGGCCGACAGTGGTGAACGCCTGAATAAAGGGCAGGCGCGACTGATCGCCGACGGTGATCTTT
TTCAACTGGGGGCATTGGCGATACGCGCAAGGCTTATCGAGCCGCCGGCCCCGCCCGGCGCGCGGCGATT
TACGGCACCGGGGCCGATTCCCGACGATGCTTTCCTGGCCCTGGACCCCATGCAGGCGCTGGATGATGAG
GACCTCACCCATCCGTCATTGGACGGGCTGGACGCATTGAGTACTGTCGCCCAAGAACCGGGGCAGTGGA
TGACTCACAGCGCGGCGGACCGAGACCATCTGGTCTTGCCTCGATGGGTGGAGCCCGACCTGGAGGAGCC
CCCGAGCCCGCAGGTTGTCACTGCGCCAGCGGACAACGAGTCCTTTTGGACGCAGTTTGCGGCAGCGCTG
GGGATCCGCCTCGACGACGTTGACAGGCCAGCGCGAGAGGCATTGGCGATCAAGGTCGCCGGCTTGCTCA
AGCTGAGTATCGAGGGGTTGCAGCACAACCTGCGCACCTGCGACGAACTGAAAAGTGAATCGAACCTGGC
GCCCGCCGCTCCCGTTGTGAACAGCCCAAACCCCCTCAGGCAGTGCGCGGATGCCGAGACGGCGTTGGCC
GCATTGTTGGGCATCAGCGAATTTGGCCAACTGCCCGCCGACCTGGCGATCACTCAAGTGCACCGGGATA
TGCAGACGCATCAGATTGCATTGCTGGCGGCATGTCGTGCCGCGGCGCGCAGCGCGCGGGAAGCGTTCGC
CCCCAGCTATCTGCTGCTGTGTTTCGAGCGCCAGGACAAATCGCCCCGGTTCAACACCGACGGTGCCCAA
TGGCGCGCCTATCAACGTCACTACCAGCGCCTGGTCGAGGCTGAACCGCTCACGGGACACCTGTTGGGCA
AGGACTTCGCCAGAGCCTATGACGAGCAGGTCCGCCTGATCTCCACCCTTCATGTGGACTACCCGGGATG
A