SecReT6
Protein ID: 568140725
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18910
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4162212..4164650 [-]
ProductATPase AAA
NoteTssH
UniProt IDV9QXV9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.80E-41, Aligned region: 202..280
AAA_2 [PF07724], Evalue: 6.80E-41, Aligned region: 545..710
AAA [PF00004], Evalue: 5.80E-17, Aligned region: 204..316
AAA [PF00004], Evalue: 5.80E-17, Aligned region: 550..678
AAA_5 [PF07728], Evalue: 4.00E-12, Aligned region: 204..221
AAA_5 [PF07728], Evalue: 4.00E-12, Aligned region: 263..334
AAA_5 [PF07728], Evalue: 4.00E-12, Aligned region: 549..665
ClpB_D2-small [PF10431], Evalue: 7.80E-12, Aligned region: 719..788
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 7..96
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 181..220
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 248..282
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 439..529
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 519..590
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 614..643
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 708..748
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 15..38
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 203..284
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 548..643
IstB_IS21 [PF01695], Evalue: 5.30E-06, Aligned region: 187..228
IstB_IS21 [PF01695], Evalue: 5.30E-06, Aligned region: 549..567
IstB_IS21 [PF01695], Evalue: 5.30E-06, Aligned region: 738..775
AAA_29 [PF13555], Evalue: 6.10E-05, Aligned region: 194..221
AAA_29 [PF13555], Evalue: 6.10E-05, Aligned region: 547..574
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 204..226
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 546..578
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 718..770
NACHT [PF05729], Evalue: 0.00031, Aligned region: 68..104
NACHT [PF05729], Evalue: 0.00031, Aligned region: 141..162
NACHT [PF05729], Evalue: 0.00031, Aligned region: 204..231
NACHT [PF05729], Evalue: 0.00031, Aligned region: 398..422
NACHT [PF05729], Evalue: 0.00031, Aligned region: 549..595
Sigma54_activat [PF00158], Evalue: 0.00051, Aligned region: 199..218
Sigma54_activat [PF00158], Evalue: 0.00051, Aligned region: 549..665
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 58..71
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 201..221
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 397..418
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 546..571
T2SE [PF00437], Evalue: 0.0019, Aligned region: 186..219
T2SE [PF00437], Evalue: 0.0019, Aligned region: 533..627
T2SE [PF00437], Evalue: 0.0019, Aligned region: 786..799
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 184..220
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 257..286
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 548..585
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 620..631
TIP49 [PF06068], Evalue: 0.0026, Aligned region: 173..224
TIP49 [PF06068], Evalue: 0.0026, Aligned region: 254..284
TIP49 [PF06068], Evalue: 0.0026, Aligned region: 548..580
AAA_17 [PF13207], Evalue: 0.0029, Aligned region: 204..246
AAA_17 [PF13207], Evalue: 0.0029, Aligned region: 549..584
Zeta_toxin [PF06414], Evalue: 0.0074, Aligned region: 204..219
Zeta_toxin [PF06414], Evalue: 0.0074, Aligned region: 548..589
Protein Sequence: 812 a.a.     [Download]
>gi|568140725|ref|YP_008933310.1| ATPase AAA [Pseudomonas sp. TKP]
MMNVDLQQLIRTLAAQTRSDLERSAERCIARGGREVLVEDLLLALLEHADGVLAKALAEANVALHELQAT
LQPKTAQCATRNPVFAQALVQWLQQALMVAHLELGRHDVDQGALLLALLRHPLEHAGSGYQGILSRLDAD
RVRDFLLSQGAQVQAVVAESWLQRFTQDLTRQAREGLIDPVICREGEIRQLIDILVRRRKNNPILVGEAG
VGKTAIVEGFALQVVASQVPPALQDVRVLTLDMGLLQAGAGIKGEFERRLKGVIDEVNASPQAVILFIDE
AHMLVGAAGPGGASDAANLLKPALARGQLRTIAATTWSEYKQYIEKDPALARRFQPVRVGEPSVEAAVSI
LRGLVPVYEASHDVYVRDDAVVAAAHMSARYLAGRQLPDKAVDVLDTACARARTCLSARPEALQCLVAEL
AEGTRQHLALRRDAEVGLPVDEVALQALSLRLDALEQERQALEQCWVEQREQPTASPTVCPRLVAQVISA
WTGIPVEQVALEPSEKVLGFADALRARILGQEPVVQALDRSLRAVAAGLNEPDAPVGVFLLAGPSGVGKT
ETALALADLLYGGQRFVTLINMSEYQEKHSLSRLIGAPPGYVGYGEGGVLTEAVRQRPYSVVLLDEVEKA
DPEVLNLFYQVFDKGLANDGEGREIDFRNTLILMTSNLGSDCISEACADGLRPDIEVLQAAILPALRAHF
KPALLARMRVVPYYPVTGEVLNDVARLKLARLGQRLQQRQLAFTHTPELVAHMVRLCTHGDSGARAIDQW
IESDLLPQIADRLLTATVGHAGLSRVHARLDSSGRPVCEFGQ
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4164650-4162212 Pseudomonas sp. TKP, complete genome
ATGATGAATGTAGACCTGCAACAATTGATACGGACATTGGCGGCGCAAACCCGCAGCGACCTGGAACGCT
CGGCTGAACGTTGTATCGCCCGGGGCGGTCGCGAAGTGCTGGTGGAGGACCTGCTGCTGGCGCTGCTGGA
GCACGCCGATGGCGTGTTGGCCAAGGCGCTGGCAGAGGCCAACGTAGCGCTGCACGAACTGCAGGCGACG
CTGCAGCCAAAGACCGCGCAGTGTGCAACCCGCAACCCGGTGTTCGCCCAGGCTTTGGTGCAGTGGTTGC
AACAGGCGTTGATGGTTGCGCACCTTGAACTGGGGCGACATGACGTTGACCAGGGCGCCCTGTTGCTCGC
GCTGCTACGTCATCCCCTGGAGCACGCCGGCAGCGGTTATCAAGGTATTTTGAGCCGTTTGGACGCTGAT
CGCGTACGTGACTTCTTATTGAGCCAGGGCGCACAAGTCCAGGCAGTGGTGGCTGAATCATGGTTGCAGC
GTTTTACCCAGGACCTGACGCGCCAGGCCCGTGAAGGCTTGATCGACCCTGTCATCTGCCGGGAGGGTGA
AATCCGGCAATTGATCGACATCCTCGTGCGTCGACGCAAGAACAACCCGATCCTGGTCGGAGAAGCCGGG
GTCGGGAAAACGGCGATTGTCGAAGGCTTCGCCCTGCAAGTGGTCGCATCGCAGGTACCGCCAGCCCTCC
AGGATGTGCGCGTGCTGACCCTTGATATGGGGCTGCTGCAAGCGGGGGCTGGTATCAAGGGCGAATTCGA
GCGCCGCCTCAAGGGGGTGATCGACGAAGTCAACGCCTCGCCCCAGGCCGTGATCCTGTTTATCGACGAG
GCTCATATGCTGGTGGGGGCCGCGGGGCCGGGTGGTGCGTCGGATGCCGCCAACCTGCTCAAGCCTGCGT
TGGCCCGCGGTCAACTGCGGACCATCGCCGCCACCACCTGGTCGGAGTACAAGCAATACATCGAAAAGGA
CCCCGCATTGGCGCGGCGTTTTCAACCGGTACGGGTGGGCGAACCGAGTGTCGAGGCCGCGGTATCGATC
CTGCGTGGACTGGTGCCGGTCTATGAGGCCAGCCATGACGTGTACGTGCGCGATGATGCGGTTGTCGCGG
CAGCGCACATGAGCGCGCGGTATTTGGCCGGGCGCCAGCTACCGGATAAAGCGGTGGATGTGCTGGATAC
GGCGTGCGCAAGGGCTCGCACGTGCTTGTCGGCGCGGCCCGAAGCCTTGCAATGCCTTGTCGCCGAGCTT
GCCGAAGGGACGCGGCAACACCTGGCGCTGCGCAGGGATGCCGAGGTCGGGCTGCCGGTCGATGAGGTGG
CCCTGCAAGCCTTGAGCCTGCGACTGGATGCCCTGGAGCAGGAGCGCCAGGCCCTGGAGCAGTGCTGGGT
TGAACAGCGCGAGCAGCCGACGGCAAGCCCGACGGTGTGCCCGCGCCTGGTGGCCCAGGTCATCAGTGCG
TGGACCGGGATTCCCGTCGAGCAAGTGGCCCTTGAACCCAGCGAAAAAGTCCTGGGGTTCGCCGATGCCT
TGCGAGCACGCATTCTGGGACAGGAGCCGGTCGTGCAGGCGCTTGATCGCAGCCTGCGGGCCGTAGCTGC
CGGCCTCAACGAACCCGATGCGCCGGTAGGTGTATTCCTGCTGGCCGGCCCCAGCGGTGTGGGCAAGACC
GAAACCGCGCTGGCGCTGGCCGACCTGCTGTACGGAGGCCAGCGGTTCGTCACCCTCATCAATATGTCGG
AGTATCAGGAAAAACACTCACTGTCTCGATTGATCGGTGCACCTCCGGGTTACGTGGGCTACGGCGAAGG
CGGTGTCCTGACCGAAGCGGTGCGGCAACGCCCTTATTCGGTGGTGTTGCTCGACGAGGTCGAGAAGGCA
GACCCGGAGGTGTTGAACCTGTTCTACCAAGTCTTCGACAAGGGCTTGGCCAATGATGGCGAAGGGCGGG
AGATCGATTTCCGTAATACGTTGATCCTGATGACCTCCAATCTTGGCAGCGACTGCATCAGTGAGGCGTG
CGCCGACGGCCTGCGCCCGGACATCGAGGTATTGCAAGCCGCGATCCTCCCCGCGCTGCGGGCACACTTC
AAACCGGCGTTGCTGGCCCGGATGCGGGTGGTGCCCTATTACCCGGTGACGGGTGAGGTGCTCAATGACG
TGGCACGCCTCAAGCTTGCGCGCCTTGGCCAGCGATTGCAGCAACGCCAGTTGGCGTTTACCCACACGCC
CGAGCTGGTGGCGCACATGGTCCGGCTCTGCACACACGGTGACAGCGGAGCGCGCGCGATCGATCAGTGG
ATCGAGTCGGACCTGCTGCCGCAGATCGCTGATCGGCTGCTGACTGCAACGGTGGGCCATGCAGGTCTGT
CACGGGTTCATGCACGGCTGGATAGCAGCGGTCGGCCAGTCTGCGAGTTCGGCCAATGA