SecReT6
Protein ID: 568140726
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18915
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4164663..4165670 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDV9QZH6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-83, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|568140726|ref|YP_008933311.1| type VI secretion protein [Pseudomonas sp. TKP]
MATPHGRAAPALTELSRFIREYSLFQAVLQVIERLRDAHPLLDEDALYDQLEFQANPGLGFPGHDIDRVE
FFVEYGQLRARLRLNVLGLCGAGSPLPAFYAEQAYAEVSGGNATRDFLDVFHHRLQRLMLPIWRKYRYRA
CFRRGASDAFSAQMFALIGLGGQDIRRAAALDCKRLLPYLGLLSLRAHSAAMIETVMRHYFKHRRLFIEQ
WVERSVSINGQQRNRLGAANHTLGQDLVLGSRVTDCSGKFTVHLLGLDWQRFHQFLPTGEDLRPLCALLR
LTARAPLEYDVRLVLAEGEIRALHIGERNVCRLGWTSWLGHERADGVVTLAGNAH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4165670-4164663 Pseudomonas sp. TKP, complete genome
ATGGCCACCCCGCATGGGCGAGCAGCCCCTGCTTTAACCGAACTGTCCCGTTTCATCCGCGAGTACTCGC
TGTTCCAGGCGGTGTTACAGGTGATCGAGCGCTTGCGTGATGCCCATCCACTGCTGGATGAGGACGCGTT
GTATGACCAATTGGAATTCCAGGCCAATCCAGGCTTGGGCTTTCCCGGACACGACATCGATCGAGTGGAG
TTTTTTGTGGAGTACGGTCAATTGCGCGCGCGGCTTCGCCTCAATGTCCTCGGGCTATGTGGCGCGGGGT
CACCACTGCCCGCGTTCTACGCGGAGCAGGCGTACGCAGAGGTGTCAGGCGGTAACGCCACCCGGGATTT
CCTGGACGTGTTTCACCACCGCCTGCAACGGCTGATGCTGCCGATCTGGCGCAAATATCGTTATCGAGCC
TGCTTCCGACGGGGCGCCAGTGATGCGTTCTCGGCGCAGATGTTTGCCTTGATCGGACTGGGAGGCCAGG
ACATTCGTCGGGCGGCAGCGCTGGACTGCAAACGGCTGCTGCCTTACCTGGGGCTGCTGAGCCTGCGCGC
GCATTCGGCGGCAATGATTGAGACGGTGATGCGCCATTACTTCAAGCACCGCCGGTTGTTCATCGAACAG
TGGGTTGAACGCAGCGTGTCAATCAACGGACAGCAGCGCAATCGGCTGGGGGCGGCCAACCACACGCTCG
GCCAGGACCTGGTGCTGGGGAGTCGGGTCACCGATTGCAGCGGCAAGTTCACCGTGCATCTGCTCGGGCT
CGACTGGCAACGATTTCACCAGTTCCTGCCGACCGGGGAGGACCTGCGCCCCTTATGTGCACTGCTGCGC
TTAACCGCGCGCGCACCGCTGGAATATGACGTGCGCCTGGTGCTCGCCGAAGGGGAGATCCGCGCGCTGC
ATATCGGCGAACGCAATGTGTGTCGCCTGGGATGGACCAGTTGGCTGGGGCATGAGCGGGCGGATGGTGT
GGTCACGCTGGCTGGCAATGCGCATTAA