SecReT6
Protein ID: 568140727
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18920
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4165634..4167421 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDV9QY86
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-183, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|568140727|ref|YP_008933312.1| type VI secretion protein [Pseudomonas sp. TKP]
MTFNRYYQSELSALRQLGRRFAERNPALAPFLAEAGQDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MQLLWPNYMRPLPSFSILQFDPLKRAGPAVRVARDTAVESAAINGERCRFRTCYSTQVMALQLSAVTYVF
QGERALLDLRLDMSAPGNFSELVFDTLRLHLAGDRHVSQGLYLGLLRHLDGIELLLLGDDGQPVNGTDGQ
AMSLRLCASQVHPVGFCEEQALIPYPVNTFRGYRLLQEYFAFPDKYLFVDVSGLDRLHGVPQALLKRVRG
MVMRFELRTQGHEPQRPGLDNVKLYCTPIVNLFNHDAVPVRLDGKQDEYLLVPGEYTRGNAAVFSVDSVT
GWRPGGLGYRHYVPFESFEHDSATPASNMAPSYSLRQRASAQHAGLDTWIAFERDQGHEQETLSIELTCT
NQNLPLQLQVGQVNQPCEQTPEFLAFRNITVPTTSLAPPLDQDFLWRLISNLSLNYLSLTDINALKVILE
TYDLPRYHSRQAQKISAKRLGALRAIRHEAVDRLLNGLPIRGVRVDLSIDTQGFLGQGETFVFASVLNEF
FALYASLNSYHELRVISTQGDVYLWPPRMGEQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4167421-4165634 Pseudomonas sp. TKP, complete genome
ATGACCTTTAATCGTTATTACCAAAGCGAACTCAGTGCCTTGCGTCAGCTGGGGCGACGTTTCGCCGAGC
GCAATCCAGCCCTGGCACCGTTTCTCGCAGAGGCCGGCCAGGACCCGGACGTGGAGCGTTTGCTCGAAGG
CTTTGCGTTTCTCACCGGCCGCCTGCGGCAGAAACTGGATGACGAATTACCCGAACTGACCCATTCGTTG
ATGCAGTTGTTGTGGCCCAACTACATGCGGCCTCTGCCATCGTTCAGCATCTTGCAGTTCGATCCGTTGA
AACGGGCAGGGCCTGCTGTCCGGGTGGCGCGCGACACCGCAGTGGAAAGCGCGGCCATCAATGGCGAGCG
CTGTCGCTTTCGGACCTGCTACAGCACCCAGGTCATGGCGCTGCAACTGAGCGCCGTGACGTATGTCTTC
CAGGGTGAGCGAGCCCTGTTGGACCTGCGGTTGGACATGAGCGCTCCGGGGAATTTCAGTGAGTTGGTGT
TCGACACGTTGCGGTTGCACCTGGCCGGGGATCGCCACGTCAGCCAGGGGTTGTACCTGGGCCTGCTGCG
TCATCTCGACGGCATCGAGTTGTTGCTTCTCGGTGATGACGGCCAGCCCGTCAACGGGACCGATGGGCAG
GCAATGTCGCTGCGGCTGTGTGCCAGCCAGGTACACCCGGTGGGGTTCTGCGAAGAACAGGCGTTGATTC
CTTACCCAGTAAATACCTTCCGTGGTTATCGCCTGCTGCAGGAGTATTTTGCCTTCCCTGACAAATACCT
GTTTGTGGATGTCAGCGGTTTGGATCGGTTACATGGGGTGCCCCAGGCACTGCTCAAACGGGTGCGTGGC
ATGGTGATGCGTTTTGAACTGCGCACCCAGGGGCATGAGCCGCAACGCCCCGGCCTGGACAACGTGAAGC
TCTATTGCACCCCCATCGTCAATCTGTTCAACCATGATGCCGTGCCCGTTCGCCTGGACGGCAAGCAGGA
TGAGTACCTGCTGGTGCCTGGGGAATATACCCGCGGCAACGCCGCGGTGTTTTCCGTGGACAGCGTGACG
GGATGGCGCCCGGGTGGCCTGGGTTATCGGCATTACGTACCGTTCGAGTCCTTTGAACACGACAGCGCCA
CCCCAGCCTCGAACATGGCCCCCAGCTACAGCCTTCGCCAGCGTGCATCGGCACAGCATGCCGGTCTCGA
CACCTGGATCGCGTTTGAGCGTGACCAGGGGCACGAACAGGAAACACTGTCGATCGAGTTGACCTGCACC
AATCAGAACCTGCCGCTGCAGCTACAGGTGGGGCAGGTCAACCAGCCCTGCGAGCAGACCCCGGAATTTC
TGGCGTTTCGAAATATCACCGTGCCGACCACGAGTCTTGCTCCGCCCCTGGACCAGGACTTCCTGTGGCG
ACTGATCAGCAACCTGTCGCTCAACTACCTGTCGTTGACCGATATCAATGCCCTGAAAGTCATCCTCGAA
ACCTACGACCTGCCGCGTTATCACAGCCGCCAGGCGCAGAAGATCAGTGCAAAGCGGTTGGGAGCGCTGC
GCGCCATCCGGCACGAAGCCGTCGACCGATTGCTCAATGGCCTGCCGATTCGCGGTGTGCGGGTGGACCT
GTCGATCGATACCCAAGGCTTCCTCGGCCAGGGCGAAACCTTTGTATTCGCTTCGGTGCTCAACGAGTTT
TTTGCGCTGTACGCCAGCTTGAATTCGTATCACGAATTGCGAGTGATCAGCACACAAGGAGATGTGTACC
TATGGCCACCCCGCATGGGCGAGCAGCCCCTGCTTTAA