SecReT6
Protein ID: 568140728
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18925
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4167411..4167812 [-]
Producthypothetical protein
NoteTssE
UniProt IDV9QZH7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 19..110
Protein Sequence: 133 a.a.     [Download]
>gi|568140728|ref|YP_008933313.1| hypothetical protein U771_18925 [Pseudomonas sp. TKP]
MTHYCSLFERLDGQAPAQANSVASIATHLGKMLSTRAGSVQTLHDYGLPDLNDLRLSLHESLSRSRLSIE
RFIQAYEPRLANVRVRLLPRDRDPLVLAFAIEATLLANGIRQPVVFSALLGDGGQVEVAPDDL
 
Nucleotide Sequence: 402 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4167812-4167411 Pseudomonas sp. TKP, complete genome
ATGACACATTACTGCAGCCTATTCGAGCGCCTTGACGGCCAGGCACCTGCCCAGGCGAACAGCGTGGCGT
CCATCGCGACGCACCTGGGCAAGATGCTCAGCACGCGTGCGGGCAGTGTCCAGACATTGCACGACTACGG
CTTGCCGGATCTCAATGACCTGCGCCTGAGCCTGCACGAATCATTGAGCCGATCGCGCCTGTCGATCGAA
CGGTTTATCCAGGCCTATGAGCCGCGTTTGGCGAACGTGCGCGTAAGGCTATTGCCCCGCGACCGCGATC
CCCTGGTCCTGGCATTTGCCATCGAGGCCACGCTGCTCGCCAATGGAATCAGGCAACCGGTGGTGTTCAG
TGCGCTTCTGGGTGATGGTGGGCAGGTCGAGGTTGCGCCGGATGACCTTTAA