SecReT6
Protein ID: 568140730
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18935
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4169329..4169826 [-]
Producthypothetical protein
NoteTssB
UniProt IDV9QXW5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-53, Aligned region: 5..159
Protein Sequence: 165 a.a.     [Download]
>gi|568140730|ref|YP_008933315.1| hypothetical protein U771_18935 [Pseudomonas sp. TKP]
MAKEGSVAPKERINITFKPAVGDAQEEVELPLKLLVLGDFTQREDLRKLEDRKPISIDKNTLDEVLAKQA
LELALSVPNRLQDAPDVEELGIQVRINSMQDFNPASLVEQIPELKKLMTLREALMALKGPLGNTPSFRKA
IEQALANDESRARVLAELGLGSSTV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4169826-4169329 Pseudomonas sp. TKP, complete genome
ATGGCCAAAGAAGGTTCGGTAGCACCCAAGGAACGCATCAATATCACCTTCAAACCTGCCGTTGGAGACG
CACAGGAAGAAGTTGAACTGCCGTTGAAGTTGTTGGTACTGGGGGATTTCACCCAGCGTGAGGACTTGCG
CAAGCTGGAAGACCGCAAGCCGATCAGTATCGACAAGAACACCCTGGACGAGGTGCTGGCCAAGCAAGCG
CTGGAGTTGGCGCTCAGCGTGCCCAATCGCCTCCAGGACGCGCCCGACGTTGAAGAGCTGGGCATACAGG
TGCGGATCAATTCGATGCAGGACTTCAACCCCGCAAGCCTGGTGGAGCAGATTCCCGAACTGAAAAAGCT
GATGACGCTGCGTGAAGCGTTGATGGCATTGAAGGGGCCACTGGGGAATACGCCGAGCTTTCGCAAGGCC
ATCGAGCAAGCCCTGGCCAATGATGAATCCCGTGCTCGGGTATTGGCCGAGTTGGGGCTGGGCAGTTCCA
CCGTATGA