SecReT6
Protein ID: 568140731
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18940
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4169861..4171330 [-]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDV9QZI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-22, Aligned region: 27..87
ImpA-rel_N [PF06812], Evalue: 7.90E-22, Aligned region: 174..183
ImpA-rel_N [PF06812], Evalue: 7.90E-22, Aligned region: 435..452
Protein Sequence: 489 a.a.     [Download]
>gi|568140731|ref|YP_008933316.1| type VI secretion protein ImpA [Pseudomonas sp. TKP]
MRFSSEYEALETELAKAQSIHGGSQPDWQLVRVISEGVLRQHSKDLRVAAWLTWALYQRESFPGLLAGLG
LLRHLCEQHWAAVHPAKMRTRGAAFGWLVLRLEPLFAQTLAIADQQPLFQAILEHLSSLDECWSACLGSD
APLLLPIRRQLSERLARTAQCGPEPAGVTAVVAQVKQAATQLLKPEAAIDNEKDAHKRLRTLQDQARPLC
TWWLRQDATDLRALRLGRTLAWLPLVSYPDADSAGITSLRGPTSDKLNRYQERFAQGHYADLVLELEASL
ASAMFWFDGLRMQWECLEALQAHLAMSEVEVSLALLLQRLPNLLGFCFHDGVPFADAATRDWIALQVNRH
LQRTSPSQISIDADAEPWERALQDVMPRLRKDGLKAAVGELRQGLHAARGERARFHWRLAQARLCVLAGK
YELARIQLEQLDHELQQAGLDRWEPGLALQVAQLLYRCCDLLPQSHAVRERKEDTHRRLCHFDLEAVLE
 
Nucleotide Sequence: 1470 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4171330-4169861 Pseudomonas sp. TKP, complete genome
GTGCGCTTCTCCAGCGAATATGAAGCCCTTGAAACCGAGCTGGCCAAGGCCCAATCGATCCACGGCGGCA
GCCAGCCAGACTGGCAGCTCGTCAGGGTCATCAGCGAAGGCGTGCTGCGTCAGCATTCCAAGGATTTGCG
GGTCGCGGCATGGTTGACCTGGGCGTTGTACCAGCGTGAATCCTTTCCTGGTTTGCTGGCGGGCCTGGGC
CTGCTGCGTCATCTTTGCGAACAGCATTGGGCGGCTGTCCACCCCGCCAAGATGCGTACCCGTGGCGCAG
CTTTCGGCTGGCTGGTGCTGCGCCTTGAGCCCTTGTTTGCGCAAACCCTTGCAATCGCGGATCAGCAACC
ACTGTTCCAAGCCATCCTTGAACACCTTTCCAGCCTGGATGAATGCTGGAGCGCATGCCTGGGAAGCGAC
GCGCCACTCCTTCTGCCGATTCGCAGGCAATTATCAGAGCGCCTGGCGCGCACGGCGCAATGCGGTCCCG
AGCCGGCCGGTGTGACGGCGGTCGTTGCACAGGTCAAGCAGGCAGCGACTCAATTGCTCAAGCCGGAAGC
TGCAATCGATAACGAAAAAGACGCACATAAGCGACTTCGCACCCTGCAGGACCAGGCTCGCCCATTGTGT
ACCTGGTGGCTGCGCCAGGACGCTACAGACCTGCGCGCATTGCGCCTGGGCCGTACGCTGGCCTGGCTGC
CCCTGGTCAGTTACCCCGACGCCGACAGTGCAGGGATCACCAGCCTGCGTGGCCCCACATCCGACAAGCT
CAACCGTTACCAGGAGCGTTTTGCCCAAGGTCATTACGCCGACCTGGTGCTTGAGCTTGAAGCGAGCCTG
GCCAGTGCGATGTTCTGGTTCGACGGTTTGCGCATGCAGTGGGAGTGCCTCGAGGCGCTGCAGGCTCATC
TGGCGATGTCCGAGGTGGAAGTCAGCCTCGCCCTGTTGTTGCAACGCCTGCCGAACCTCCTCGGGTTCTG
CTTTCACGACGGCGTTCCGTTTGCGGATGCTGCGACTCGCGACTGGATTGCGCTGCAGGTGAATCGCCAT
CTGCAAAGAACCTCACCCTCGCAGATATCGATCGATGCCGACGCCGAGCCGTGGGAGAGGGCGTTGCAGG
ATGTCATGCCACGGTTGCGCAAGGACGGGCTCAAGGCCGCCGTCGGGGAACTCAGGCAGGGCCTGCATGC
CGCACGCGGCGAGCGAGCGCGCTTCCATTGGCGTTTGGCCCAGGCCCGGTTGTGTGTACTGGCCGGCAAG
TACGAGCTGGCGAGAATCCAGCTTGAACAGTTGGATCATGAACTGCAGCAGGCGGGGCTGGACCGTTGGG
AGCCTGGCCTGGCGCTGCAGGTGGCGCAGTTGCTGTATCGCTGCTGCGACCTGTTGCCACAAAGCCATGC
CGTGCGGGAGCGCAAGGAAGACACCCATCGCAGGTTGTGCCACTTCGACCTGGAAGCGGTACTTGAATAG