SecReT6
Protein ID: 568143105
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31080
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6792321..6792974 [-]
Producttype VI secretion system protein ImpM
NoteTagF
UniProt IDV9R4K9
KEGG IDpsk:U771_31080
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 2.90E-49, Aligned region: 5..142
DUF2094 [PF09867], Evalue: 2.90E-49, Aligned region: 200..210
Protein Sequence: 217 a.a.     [Download]
>gi|568143105|ref|YP_008935690.1| type VI secretion system protein ImpM [Pseudomonas sp. TKP]
MTTLGFYGKLASRGDFVSRALPQSFIGPWDSWLAAGLLASQQSLGAEWLNVYLVSPLWRFVLAPGVCGPN
AAAGVVMPSIDRVGRYFPLAVVALLDHDTNPASLVGGPDTWFEQAEELLLGTLDADATFERFNDGLDSLG
LPAIEPRAVDSRFAGLQRVAATEPHQRMTALAEQACDGASLWWGRGSQTISPGLLRCQGLPATGDFAQFL
LGQEGVM
 
Nucleotide Sequence: 654 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c6792974-6792321 Pseudomonas sp. TKP, complete genome
ATGACGACGCTGGGTTTCTACGGCAAGTTGGCCAGTCGTGGGGACTTTGTCAGCCGCGCCTTGCCCCAGA
GCTTTATTGGCCCATGGGACAGCTGGTTGGCGGCGGGTTTGCTCGCCAGCCAGCAGAGCCTGGGCGCCGA
GTGGCTCAACGTGTACCTGGTCAGCCCGCTGTGGCGCTTTGTGTTGGCGCCGGGTGTGTGCGGACCGAAC
GCGGCGGCGGGCGTGGTGATGCCGAGCATCGATCGGGTGGGGCGGTATTTCCCGCTGGCGGTGGTGGCCT
TGCTCGATCACGACACCAACCCGGCTTCTCTGGTGGGCGGTCCGGACACCTGGTTCGAACAGGCCGAAGA
GCTGTTGCTCGGCACCCTCGACGCCGACGCTACCTTTGAACGCTTCAACGATGGCCTCGACAGCTTGGGC
TTGCCGGCGATTGAGCCGCGAGCGGTCGACAGCCGTTTCGCCGGCCTGCAACGTGTGGCCGCCACCGAGC
CCCACCAGCGCATGACCGCGCTCGCCGAACAGGCCTGCGACGGTGCCAGCCTGTGGTGGGGCCGTGGTTC
GCAGACGATTTCCCCTGGTTTATTGCGGTGTCAGGGCCTGCCCGCCACCGGCGATTTTGCGCAGTTTTTG
CTCGGACAAGAGGGTGTGATGTAG