SecReT6
Protein ID: 568143107
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31090
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6796468..6797757 [-]
Producttype VI secretion protein
NoteTssL
UniProt IDV9R4H1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-69, Aligned region: 46..251
OmpA [PF00691], Evalue: 6.20E-15, Aligned region: 319..417
DUF883 [PF05957], Evalue: 0.00052, Aligned region: 70..120
DUF883 [PF05957], Evalue: 0.00052, Aligned region: 181..248
DUF883 [PF05957], Evalue: 0.00052, Aligned region: 315..353
Protein Sequence: 429 a.a.     [Download]
>gi|568143107|ref|YP_008935692.1| type VI secretion protein [Pseudomonas sp. TKP]
MHPNDDDRTQFMPRPGGRAPEPVRAEPAPLSMPAAPILTGKSQGLNPLESAAGPLLALLTRLRNTIAHPA
PASLRAQLLAYLRQFEERAEAAGVARNEVLLARYALCTALDEAVLSTPWGSTSDWGKQSLLITVHNEAWG
GEKVFQLLDHCLQSPRERLYLLELLYLCMCLGFEGRYRVINDGRSQLEALRERTAAAIRSARGDHERELS
PHWRGVSVARDRLAQFMPPWIAVAIGLALLLALLFGLRMKLASDAEPVFKNIHALGEIPVQAIDRPVAQP
KVIERPRLAGFLAEDIKAGRVAVEDQVDRSVVTIRGDELFASASSSIVDDYQPLMLRIADAIRKVKGQVR
VTGHSDNRPIATLRFPSNWALSEARAKSVLDILAAKTGQGDRFSAEGRSDTEPVATNATAEGRARNRRVE
ITVLAEGVE
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c6797757-6796468 Pseudomonas sp. TKP, complete genome
ATGCATCCCAATGATGATGACCGCACCCAGTTCATGCCGCGCCCGGGTGGCCGTGCGCCGGAACCTGTGC
GTGCAGAGCCGGCGCCGCTGTCGATGCCGGCGGCACCGATCCTGACCGGCAAAAGCCAGGGGCTTAACCC
GCTGGAAAGCGCCGCCGGCCCGCTATTGGCGTTGCTGACACGCCTGCGCAACACCATTGCCCACCCCGCA
CCGGCCAGCTTGCGTGCGCAACTGCTGGCCTACCTGCGCCAGTTCGAAGAACGTGCGGAAGCGGCCGGTG
TGGCACGCAATGAAGTGCTGCTGGCGCGGTATGCGCTCTGCACCGCCCTCGATGAAGCGGTGTTGAGCAC
GCCGTGGGGCAGCACCAGCGACTGGGGCAAGCAGAGCCTGTTGATCACCGTGCATAACGAAGCCTGGGGC
GGCGAAAAAGTCTTCCAGTTGCTCGACCACTGCCTGCAAAGCCCGCGCGAGCGCCTGTACCTGCTGGAAT
TGTTGTACCTGTGCATGTGCCTCGGGTTCGAGGGCCGCTACCGCGTGATCAACGACGGTCGCAGCCAGTT
GGAAGCCCTGCGTGAGCGCACCGCTGCGGCGATTCGCAGTGCCCGTGGCGACCACGAACGCGAGTTATCG
CCGCACTGGCGCGGCGTCAGCGTCGCGCGGGATCGCCTGGCGCAGTTCATGCCGCCATGGATCGCGGTGG
CTATCGGCCTGGCGCTGCTGCTGGCGTTGCTGTTCGGCTTGCGCATGAAGCTGGCATCGGACGCCGAGCC
GGTGTTCAAGAACATTCATGCCTTGGGCGAGATCCCGGTGCAGGCCATCGACCGTCCGGTGGCGCAGCCC
AAAGTCATCGAGCGGCCACGCCTGGCCGGCTTCCTGGCGGAGGACATCAAGGCGGGTCGTGTGGCAGTAG
AAGATCAGGTCGACCGTTCAGTCGTGACCATTCGTGGCGACGAACTCTTTGCGTCCGCCAGCTCCAGCAT
CGTCGATGACTACCAGCCGCTGATGCTGCGCATCGCCGACGCCATTCGCAAGGTCAAGGGCCAGGTGCGT
GTCACCGGGCACAGCGACAACCGCCCGATTGCCACGCTGCGCTTCCCGTCCAACTGGGCGCTGTCCGAAG
CGCGGGCCAAGTCGGTGCTGGACATCCTGGCAGCCAAGACCGGCCAAGGCGACCGCTTCAGCGCCGAAGG
CCGCAGCGACACCGAGCCGGTGGCCACCAACGCCACCGCCGAAGGCCGTGCCCGCAATCGCCGGGTTGAA
ATCACCGTATTGGCGGAGGGCGTCGAGTGA