SecReT6
Protein ID: 568143108
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31095
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6797764..6799098 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDV9R5V5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-156, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|568143108|ref|YP_008935693.1| type VI secretion protein [Pseudomonas sp. TKP]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKLAIVSARGLLP
DGTPFNIPQDDLAPSPLNIDDNLRDGLVYLALPLKRAGARDTVDDGEDLGAARYVSQVREVRDDNAPFEN
RAPVAVGSRALRLLTAQDGISDYAAIGLVRIKEKRADRALVLDDTYIPPVLDVAASKPLSAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHFNQLSPLHPERFFSELVSLAGEFSTFSTSG
RRPQEYPQYQHDDLALSFAPVMAALREALSMLIDSKATPIPIVEKAYGIHVAMLADKTLLDSASFILVVR
ADVPGETLRARFGQQSKVGSVEHIRDLVNLQLPGISLLPLPVAPRQIPYHAGSTYYELDRGSEHWQQLGN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c6799098-6797764 Pseudomonas sp. TKP, complete genome
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATCGGAACGCAGCACTTCCAGCAGCATG
ACCGTTACCTGGAAAACCTGATCGACGCCCGCAGCCGTCCGCTGTCCGCCGGCGCCTGGGGCTTTTCCGA
GTTGCTGATCGACCAGGGCCTGCTGGCCCAGGGCAAGCTGGCGATCGTGTCGGCACGCGGCCTGTTGCCC
GACGGCACGCCGTTCAATATTCCCCAGGATGACCTCGCGCCGAGCCCGTTGAATATCGACGACAACCTGC
GCGACGGCCTGGTCTACCTGGCCTTGCCCCTCAAGCGCGCGGGTGCCCGCGACACCGTCGACGACGGCGA
AGACCTTGGCGCCGCGCGTTACGTGAGCCAGGTGCGCGAAGTGCGCGACGACAACGCCCCGTTCGAGAAC
CGCGCCCCAGTGGCCGTTGGCTCCCGTGCCTTGCGCCTGCTGACCGCGCAGGATGGCATCAGCGATTACG
CCGCCATCGGCCTGGTGCGCATCAAGGAAAAACGCGCCGACCGCGCGCTGGTCCTCGACGACACTTATAT
CCCGCCGGTATTGGACGTGGCCGCGAGCAAACCGCTGAGCGCATTTCGCAGTGAACTGCTTGGCCTGCTG
CACCAGCGTGGCGAAGCCCTGGCGGGCCGTGTGGTGGCCTCGGGTGCCGGTGGGGCGTCGGAGATTGCCG
ACTTCATGCTGTTGCAACTGGTCAACCGTGCCCAACCGCTGATCCAGCATTTCAACCAGTTGAGCCCGCT
GCATCCGGAGCGCTTCTTCAGCGAACTGGTCAGCCTGGCCGGTGAGTTTTCCACCTTTTCCACCAGCGGC
CGTCGCCCCCAGGAATACCCGCAGTACCAGCACGACGACCTGGCCCTGAGCTTCGCCCCGGTGATGGCGG
CGCTGCGCGAAGCGTTGTCGATGCTGATCGACAGCAAGGCCACGCCGATCCCGATCGTGGAGAAAGCCTA
TGGCATCCACGTGGCGATGCTGGCCGACAAGACCCTGCTCGACAGCGCCAGCTTCATTCTCGTGGTGCGT
GCCGATGTGCCTGGTGAAACCCTGCGCGCGCGCTTCGGCCAGCAGAGCAAGGTCGGCTCGGTGGAGCACA
TCCGTGACCTGGTCAACCTGCAACTGCCGGGCATCAGCCTGCTGCCGTTGCCGGTGGCGCCACGTCAGAT
TCCCTACCACGCGGGCAGTACCTATTACGAGCTGGACCGTGGCAGCGAGCACTGGCAGCAGTTGGGCAAC
TCCGGCGGTTTCGCCTTCCATATCGCCGGGCAGTTCCCGGGTTTGAACCTGGCCTTCTGGGCGATCCGAG
GATAA