SecReT6
Protein ID: 568143109
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31100
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6799117..6799626 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDV9R781
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.30E-39, Aligned region: 12..154
Protein Sequence: 169 a.a.     [Download]
>gi|568143109|ref|YP_008935694.1| type VI secretion protein [Pseudomonas sp. TKP]
MIPRFLLAVATALLLTACAKDAAKPETAAEAEVDTAAVELHFHAIAGLNPGANGQAAPVRVRIFELKNAA
TFARSDYFALADRAQSTLGLDLLDQDEVMVQPGQQLSIQRDLDPSTRQIGLLVGYRELDRAQWRTVINVP
ARQYTEYQISLDVRAVRADVVATPSSPAQ
 
Nucleotide Sequence: 510 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c6799626-6799117 Pseudomonas sp. TKP, complete genome
ATGATTCCCAGGTTTTTACTCGCAGTCGCTACCGCGCTGCTGCTGACCGCGTGTGCCAAGGACGCGGCCA
AACCCGAAACAGCCGCTGAGGCTGAAGTGGACACCGCCGCCGTCGAGTTGCATTTCCACGCCATTGCCGG
GCTTAACCCCGGCGCCAACGGCCAGGCCGCCCCGGTGCGGGTACGGATTTTCGAACTGAAGAACGCCGCC
ACCTTCGCCCGCTCCGATTACTTCGCCCTGGCTGACCGCGCGCAATCCACCCTCGGCCTGGACCTGCTGG
ACCAGGACGAAGTCATGGTGCAACCCGGCCAGCAACTGAGCATCCAGCGCGACCTCGACCCCTCCACGCG
CCAGATCGGCTTGCTGGTGGGTTATCGCGAGCTGGACCGCGCGCAATGGCGCACGGTGATCAACGTGCCC
GCGCGCCAATACACCGAATACCAGATCAGCCTCGATGTGCGTGCCGTGCGCGCCGACGTCGTGGCTACCC
CATCCAGCCCTGCCCAATAA