SecReT6
Protein ID: 568143110
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31105
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6799678..6801033 [-]
Producttype VI secretion protein
NoteFha
UniProt IDV9R4L3
KEGG IDpsk:U771_31105
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.70E-16, Aligned region: 30..97
Protein Sequence: 451 a.a.     [Download]
>gi|568143110|ref|YP_008935695.1| type VI secretion protein [Pseudomonas sp. TKP]
MSLCLTITSYHKITPGQCSEKSMNQGSMAIGRSSDNDWVLPDPERLVSSQHCVIQYKDGRYYLTDNSTNG
VELVNAGIRMRRGNSEPLQDGELIRIGDYEIQARIDFNVQAVDSQPFAGDSPNSFEALMGAVANKPAPTP
VIAPQFHGASSMDTLPDLFDFLSPTAVPPPTVPDHVPSEQHDFRPPTPVAVPVIEKPAVSGAVIPEDWDL
FGDTPAPLTSAPPPAPTPPPVPTPPPAPSVPSPPVVEPVLPVADTRQPDLLQAFLRGAGLDQLRLDKADA
CAQMESIGRSYRLMVEGLIDVLRARASLKGEFRMQQTMIQPAENNPLKFAPNADEALLLLLRHGNQAFMA
PDLAVRDSFDDLRAHQLAVMAGVEAAIKHLLGRFEPAQLEERMGKPGGLSSLFNGSRQAQYWQQFTELYS
NISREAQEDFQDLFGREFSRAYEEHSARQRR
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c6801033-6799678 Pseudomonas sp. TKP, complete genome
ATGTCGCTGTGTTTGACTATCACTAGTTATCACAAGATTACCCCGGGGCAGTGCTCCGAAAAGTCCATGA
ACCAGGGCTCGATGGCTATCGGCCGCAGCTCGGATAATGACTGGGTATTGCCCGACCCTGAGCGCCTGGT
GTCTTCGCAACACTGCGTTATTCAATACAAAGATGGCCGTTATTATTTAACCGATAACAGTACAAATGGT
GTGGAGTTGGTTAACGCCGGTATTCGTATGCGCCGGGGTAATAGCGAGCCGCTGCAGGATGGCGAGTTGA
TCCGCATCGGCGATTACGAAATCCAGGCACGTATCGATTTCAACGTGCAGGCCGTCGATAGCCAGCCGTT
TGCCGGTGATTCACCGAACAGTTTTGAGGCTTTGATGGGCGCCGTGGCGAACAAGCCCGCGCCGACGCCC
GTGATTGCGCCGCAGTTCCACGGCGCTTCGTCGATGGACACCCTGCCCGACCTGTTCGACTTCCTCAGCC
CCACCGCCGTACCGCCGCCCACCGTGCCGGACCACGTACCCTCCGAGCAACACGACTTCCGCCCACCTAC
GCCGGTCGCGGTGCCGGTGATCGAGAAGCCTGCGGTATCCGGCGCGGTGATTCCCGAAGACTGGGACCTG
TTTGGCGATACGCCAGCGCCGTTGACCAGCGCGCCGCCGCCCGCGCCGACACCACCCCCCGTACCGACAC
CGCCGCCTGCACCGAGCGTGCCGTCGCCCCCCGTGGTCGAGCCCGTGCTCCCCGTGGCCGATACCCGGCA
ACCCGACCTCCTGCAAGCCTTCCTGCGTGGCGCGGGCCTGGATCAACTGCGCCTGGACAAGGCCGATGCC
TGTGCGCAGATGGAAAGCATCGGCCGCAGCTACCGCCTGATGGTCGAGGGCTTGATCGACGTGTTGCGCG
CCCGCGCCAGTCTCAAGGGCGAGTTCCGCATGCAGCAGACGATGATCCAACCCGCCGAAAACAATCCGTT
GAAATTCGCACCGAACGCCGACGAAGCGTTACTGCTGCTGCTTCGCCATGGCAACCAAGCGTTTATGGCT
CCGGATCTCGCCGTGCGCGACAGTTTCGACGATCTGCGCGCCCATCAGTTAGCGGTGATGGCGGGGGTGG
AAGCGGCGATCAAACACCTGCTCGGCCGCTTCGAACCGGCACAACTGGAAGAACGCATGGGCAAACCCGG
CGGGCTGTCGAGCCTTTTCAACGGTTCGCGCCAGGCCCAGTACTGGCAGCAATTCACCGAGCTCTACAGC
AATATTTCCCGCGAGGCCCAGGAAGATTTCCAGGACCTGTTCGGCCGCGAATTCAGCCGAGCCTACGAAG
AACACAGCGCACGCCAGCGTCGCTGA