SecReT6
Protein ID: 568143111
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31110
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6801428..6802447 [+]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDV9R797
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 53..112
ImpA-rel_N [PF06812], Evalue: 2.50E-18, Aligned region: 211..223
Protein Sequence: 339 a.a.     [Download]
>gi|568143111|ref|YP_008935696.1| type VI secretion protein ImpA [Pseudomonas sp. TKP]
MDVPLLLTAVSATSPCGEDMEYDAQFLQLERDAKGQPERSMGDSILPAEPPEWRSIQQQSLDLLQRSKDL
RITHFLLQSSLALQGVAGLAEVLTLINALLREYWADLHPHLDADDDNDPTVRINALSGLTSDATIRLLRE
SILTRSRTFGPVSLRAALSASGLMNFPDEQLGAQQLNAAFLDSDPEQLQATRDALSTARAACEAIEQQVS
DQVGSAQGVDLSLLKQPLKQALQILNQAVPDPTSSREPEAVSDDNAPSVDFAAAPAAPRPTGDIANRDDV
LRSLDKILAYYTRHEPSSPLPVLLNRAKHLVHADFAAIVRNLIPDGMSQFENLRGPDGE
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6801428-6802447 Pseudomonas sp. TKP, complete genome
GTGGATGTGCCGTTGCTGCTCACCGCCGTTTCCGCGACTTCGCCGTGTGGTGAAGACATGGAATATGACG
CGCAATTTTTGCAATTGGAGCGTGATGCCAAGGGCCAACCCGAGCGCAGCATGGGCGACTCGATCCTGCC
CGCTGAACCGCCGGAGTGGCGCAGCATCCAGCAGCAAAGCCTTGACTTGCTGCAACGCAGCAAAGACCTG
CGCATCACCCATTTCCTGCTGCAAAGCTCCCTCGCCCTGCAAGGCGTGGCCGGGCTGGCTGAAGTCCTCA
CGCTGATCAACGCGCTGCTGCGCGAATACTGGGCCGACCTGCACCCGCACCTGGATGCCGACGACGATAA
CGACCCCACCGTGCGCATCAACGCCCTGTCTGGCCTGACCAGCGACGCGACCATTCGTCTGTTGCGCGAA
AGCATCCTCACGCGCTCGCGCACCTTCGGCCCCGTGAGCCTGCGCGCTGCGCTCAGCGCCAGCGGCCTGA
TGAATTTCCCCGATGAACAACTCGGCGCCCAGCAACTCAACGCCGCGTTCCTCGACAGCGATCCCGAACA
ACTGCAGGCCACCCGTGACGCCTTGAGCACGGCGCGCGCCGCTTGCGAAGCCATCGAGCAGCAGGTCAGC
GACCAGGTCGGTTCAGCCCAGGGCGTGGACCTCAGCCTGCTGAAGCAGCCGCTCAAGCAGGCGTTGCAAA
TACTCAACCAAGCCGTACCCGACCCTACAAGCAGCCGCGAACCCGAGGCCGTCAGTGACGACAATGCCCC
CTCGGTCGATTTCGCCGCTGCCCCCGCCGCACCTCGCCCCACTGGCGACATCGCCAACCGCGACGACGTG
CTGCGCAGCCTCGACAAGATCCTTGCGTACTACACCCGGCACGAGCCTTCGAGCCCGCTGCCGGTGTTGT
TGAACCGGGCCAAACATCTGGTGCACGCCGACTTCGCGGCCATCGTGCGCAACCTGATTCCCGATGGCAT
GTCCCAATTTGAAAACCTGCGCGGCCCGGACGGCGAGTAA