SecReT6
Protein ID: 568143112
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31115
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6802502..6803008 [+]
Producthypothetical protein
NoteTssB
UniProt IDV9R4H4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.10E-60, Aligned region: 10..163
Protein Sequence: 168 a.a.     [Download]
>gi|568143112|ref|YP_008935697.1| hypothetical protein U771_31115 [Pseudomonas sp. TKP]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAPVADRKFLEVDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLKQLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPAGEQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6802502-6803008 Pseudomonas sp. TKP, complete genome
GTGGCGAAGCAAAGTTCTCAGAAATTCATCGCGCGCAACCGCGCGCCTCGAGTGCAGATCGAGTACGACG
TCGAGCTCTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTGATGGGTGTGATGGCCGACCTCGCCGG
CAAGCCTGCCGAGCCTCTGGCGCCTGTGGCCGACCGCAAGTTCCTTGAAGTGGATGTCGATAACTTCGAC
TCGCGCCTCAAGGCCATGCAGCCACGCGTGGCGTTCCACGTACCCAACGAGCTGACCGGTGAAGGCAACC
TGAGCCTGGATATCACCTTCGAAAGCATGGACGACTTCAGCCCGGCCGCCGTGGCCCGCAAGGTCGACTC
GCTCAAGCAACTGCTCGAAGCCCGCACCCAACTGGCCAACCTGCTGACCTACATGGACGGCAAGACTGGC
GCTGAAGAAATCATCATGAAGGCGATCAAGGACCCGGCACTGCTTCAGGCACTTGCCAGCGCGCCTAAGC
CTGCAGGGGAGCAGTAA