SecReT6
Protein ID: 568143113
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31120
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6803011..6804507 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV9R5V8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-196, Aligned region: 67..493
BMFP [PF04380], Evalue: 0.001, Aligned region: 21..79
Protein Sequence: 498 a.a.     [Download]
>gi|568143113|ref|YP_008935698.1| EvpB family type VI secretion protein [Pseudomonas sp. TKP]
MTDNTAREGAQSLGAIEETSEFASLLMQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESI
IAAIDAKLTAQVNQIIHHPDFQQLESAWRGLHYLVNNTESDEQLKIRVLNISKPDLHKTLKKFKGTAWDQ
SPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHAPFIAAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWA
NAAYAMAVNINRSFKHYGWCSRIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEDVEGNPGYYNSKFYLRPHYQLEGLTVSLRLVS
KLPSAKSA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6803011-6804507 Pseudomonas sp. TKP, complete genome
ATGACTGACAATACCGCCCGCGAAGGCGCCCAGAGCCTGGGTGCAATTGAGGAAACCAGCGAGTTCGCAT
CCTTGTTGATGCAGGAATTCAAGCCTAAGACCGAGCGTGCCCGCGAAGCCGTGGAAACCGCCGTGCGCAC
CCTGGCCGAACAGGCCCTGGCGCAAACCGACCTGGTGTCCAACGACGCGATCAAGTCGATCGAATCGATC
ATCGCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGATCATCCACCACCCGGATTTCCAACAGT
TGGAAAGCGCCTGGCGTGGCCTGCACTACCTGGTCAACAACACCGAGAGCGATGAGCAGCTCAAGATTCG
CGTGCTCAACATCTCCAAGCCGGACCTGCACAAGACCCTGAAGAAATTCAAGGGCACGGCCTGGGACCAG
AGCCCGATCTTCAAGAAGATGTACGAAGAAGAATACGGCCAGTTCGGCGGCGAACCGTACGGTTGCCTGG
TAGGCGACTACTACTTCGACCAGTCGCCACCCGATGTCGAGCTGCTGGGCGAGCTGTCGAAAGTCTGCGC
CGCCATGCACGCCCCGTTCATCGCTGCGGCTTCGCCGACCGTGATGGGCATGGGCTCGTGGCAGGAACTG
TCGAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGCTGCGTGAAT
CGGAAGACTCGCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCGTATGGCGCCAAGAC
CGACCCGGTGGAAGCCTTCGCTTTCGAAGAAAACACCGACGGCGCCGACAGCTCCAAGTACACCTGGGCC
AACGCGGCCTATGCGATGGCGGTGAACATCAACCGTTCGTTCAAGCACTACGGCTGGTGCTCGCGCATCC
GTGGCGTGGAGTCTGGCGGTGAAGTGGAAAACCTGCCGGCCCACACGTTCCCTACCGATGACGGTGGCGT
GGACATGAAGTGCCCGACCGAAATCGCCATCAGCGACCGCCGTGAAGCGGAACTGGCGAAGAACGGTTTC
ATGCCGCTGCTGCACAAGAAAAACACCGACTTCGCCGCGTTCATCGGTGCGCAGTCGTTGCAGAAACCGG
CCGAATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTTCGCCAC
CTGCCGTTTCGCTCACTACTTGAAGTGCATCGTGCGCGACAAGATCGGTTCCTTCAAAGAGAAGGACGAG
ATGCAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGCGACCCGGCGCACTCCACCGAAACCA
CCAAGGCCCAGCACCCGCTCGCTGCCGCTGAAGTGATCGTGGAGGACGTCGAAGGCAACCCGGGTTACTA
CAACTCCAAGTTCTACCTGCGCCCGCACTACCAGCTCGAAGGGCTGACCGTGTCGTTGCGCCTGGTATCG
AAGCTGCCTTCGGCAAAAAGCGCGTAA