SecReT6
Protein ID: 568143114
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31125
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6804683..6805171 [+]
Producthypothetical protein
NoteTssD
UniProt IDV9R784
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|568143114|ref|YP_008935699.1| hypothetical protein U771_31125 [Pseudomonas sp. TKP]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGGGGGAGKVNIQDLSLTKYVDKASPNLM
MHCASGKHIDKVKLTVRKAGGESQVEYMIINLEEVLVTSLSTGGSGSDDRLTENVTLNFAQVMVDYQPQK
ADGTKDGGAIKFGWNIRSNTKR
 
Nucleotide Sequence: 489 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6804683-6805171 Pseudomonas sp. TKP, complete genome
ATGGCTGTTGATATTTTCATCAAGATCGGCGACATCAAGGGCGAGTCCATGGACAAGGCCCACAAGGACG
AGATCGACGTGCTGAACTGGAGCTGGGGCATGTCCCAGTCCGGCAACATGCACGTCGGCGGTGGCGGCGG
CGCGGGCAAGGTGAATATCCAGGACCTGTCGCTGACCAAGTACGTCGACAAGGCGTCGCCGAACCTGATG
ATGCACTGCGCCAGCGGCAAGCACATCGACAAGGTCAAGCTGACCGTGCGCAAGGCCGGTGGCGAAAGCC
AGGTCGAGTACATGATCATCAACCTGGAAGAAGTGCTGGTCACGTCCCTGAGCACCGGCGGTTCGGGCAG
CGATGACCGCCTGACTGAAAACGTCACCCTGAACTTCGCCCAAGTGATGGTCGACTACCAGCCGCAGAAA
GCCGACGGCACCAAAGACGGCGGCGCGATCAAGTTTGGCTGGAACATCCGTTCCAACACCAAGCGCTGA