SecReT6
Protein ID: 568143115
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31130
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6805262..6805780 [+]
Producthypothetical protein
NoteTssE
UniProt IDV9R4M0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-23, Aligned region: 38..147
Protein Sequence: 172 a.a.     [Download]
>gi|568143115|ref|YP_008935700.1| hypothetical protein U771_31130 [Pseudomonas sp. TKP]
MVVTEIASRDRLQPSLLDRLTDDDPTNPKESADKRVLSLTQLKASVLRDLAWLLNTTSLLDADATLHTQA
GTSVVNYGLPALAGNSVSSVDIKALEALIYQAIATFEPRILRHTLRVKARVGHGEMNHNALSFEIEGDLW
AQPVPLRLLLQTDLDLESGHVRVVNADQRRRP
 
Nucleotide Sequence: 519 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6805262-6805780 Pseudomonas sp. TKP, complete genome
TTGGTGGTAACTGAAATCGCTTCCCGCGACCGTCTGCAACCGTCCCTGCTGGACCGGTTGACCGACGACG
ACCCAACCAATCCCAAGGAAAGCGCGGATAAACGCGTATTGTCCCTGACCCAATTGAAGGCCTCGGTGCT
GCGCGACCTGGCGTGGCTGCTCAACACCACGTCGTTGCTCGATGCCGATGCCACGCTGCACACACAAGCA
GGCACCTCGGTGGTCAATTACGGCCTGCCGGCGCTGGCGGGCAACAGCGTTTCCAGCGTTGATATCAAGG
CCCTGGAAGCCCTGATCTACCAGGCGATCGCCACCTTTGAACCACGCATCCTGCGCCACACCCTGCGCGT
CAAAGCCCGCGTCGGCCATGGCGAGATGAATCACAACGCCCTGAGTTTCGAGATCGAAGGCGACCTGTGG
GCGCAGCCGGTGCCATTGCGCCTGTTGCTGCAAACCGACCTCGACCTGGAATCCGGCCATGTGCGCGTGG
TCAATGCCGACCAGCGGAGGCGCCCATGA