SecReT6
Protein ID: 568143116
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31135
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6805777..6807636 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDV9R7A3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.90E-219, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|568143116|ref|YP_008935701.1| type VI secretion system protein ImpG [Pseudomonas sp. TKP]
MNPRLLELYNQELHHVRESAAEFAKEYPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQTDPDEGSLASGFPLPHDTVLRAALGRETQTCCEYRTAHPVTLWP
LQVSGAEYFGNPAAVLGRLAASEPKAKAGLRLTLRTGAELPFNSLDLDNLPLYLSGADEQPFRLYEQLLG
NACAVFARKPGGDWVERLPQGALRSRGFDDADAAMPVVARAFQGYRLLQEYFALPHRFLFVEFAELSRAV
KRCDGQELELIVLFDRHEPSLEGSVGAAQFLPFCTPAINLFPKRVDRIHLSDRVNEHHVIADRTRPMDFE
IHSLSGITGHGTGPEQPFLPFYAVRDPSRYGRDQAYYTVRREPRVLSSDQRRNGPRSTYVGSETFVSLVD
SRQAPYRHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVLSVRCVAGPSRPRASHAHDAKAWRL
ISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVLERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6805777-6807636 Pseudomonas sp. TKP, complete genome
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCCGCCGAGTTCG
CCAAGGAATACCCGAAGATCGCCAGTCGGCTGACCCTGTCCGGTATGGACTGCGCCGACCCGTACGTCGA
ACGCTTGCTGGAGGGCTTTGCCTACCTCACTGCCCGCGTGCAGCTCAAGCTCGACGCCGAGTACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCACTACCTGGCGCCGACCCCGTCGATGACCGTGGTGC
AGTTGCAGACCGATCCCGATGAAGGCTCCCTGGCCAGCGGCTTCCCGCTGCCGCACGACACCGTGTTGCG
CGCCGCCTTGGGCCGCGAAACCCAGACCTGCTGCGAGTACCGCACCGCGCATCCGGTGACGTTGTGGCCG
TTGCAGGTCAGTGGCGCCGAGTACTTCGGCAACCCCGCCGCCGTGCTCGGGCGCCTGGCCGCCAGTGAGC
CGAAAGCCAAGGCCGGCTTGCGACTGACCCTGCGCACCGGCGCCGAATTGCCGTTCAACAGCCTCGACCT
GGACAACCTGCCGCTGTACCTCAGCGGTGCCGACGAGCAGCCGTTCCGCCTTTACGAACAACTGCTGGGC
AACGCCTGCGCGGTGTTTGCGCGCAAGCCCGGTGGCGATTGGGTCGAACGCCTGCCACAAGGCGCATTGC
GCTCGCGGGGCTTCGACGACGCCGATGCCGCCATGCCAGTGGTGGCGCGAGCGTTCCAGGGCTACCGCCT
GTTGCAGGAGTACTTCGCCCTGCCCCACCGCTTCCTGTTCGTCGAGTTCGCCGAGCTGAGCCGTGCGGTC
AAGCGTTGCGACGGCCAGGAACTGGAACTGATCGTGCTGTTCGACCGTCACGAACCGAGCCTGGAAGGCA
GCGTCGGCGCGGCGCAGTTTTTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGAAGCGCGTGGACCG
TATCCACTTGTCCGACCGGGTCAACGAACACCATGTGATCGCCGACCGCACGCGGCCGATGGATTTCGAG
ATTCATTCGTTGAGCGGCATCACCGGCCACGGCACCGGGCCAGAGCAGCCATTTTTGCCGTTCTATGCGG
TACGCGATCCATCGCGGTATGGCCGCGACCAGGCTTACTACACCGTGCGCCGCGAGCCACGGGTGTTGTC
CAGCGACCAGCGCCGCAACGGCCCGCGCTCCACCTATGTGGGCAGCGAAACCTTTGTCAGCCTGGTCGAC
AGCCGCCAGGCGCCGTATCGCCACGACCTGCGCCAGCTTGGCGTGACCGCGTTGTGCACCAACCGCGATT
TGCCGCTGTTCATGAGCGTGGGCAACGGCAAGACCGACTTCACCCTGGCCGACAGTGCGCCGGTTTTATC
CGTGCGTTGCGTCGCCGGGCCAAGCCGCCCGCGCGCCAGCCATGCCCATGATGCCAAGGCCTGGCGCCTG
ATCAGCCAGTTGTCCCTCAACTATTTGTCCCTGAGCGAACAGGGCCAGGGCGCGGCGGCATTGCGCGAAC
TGCTACGCCTGTACGGCGACAGCAACGACGCCGCCCTGCAATTGCAGATCGAAGGCCTGCGTGAGGTCAG
CAGCAAGGCGGTCACTCGCCGCTTGCCGATGCCCGGCCCGATTGTGTTTGGTCGTGGCCTGGAAATTACC
TTGGAGTTTGATGAAAACGCGTTTCGCGGCACCGGCGTGTTCCTGCTCGGTGCGGTGCTGGAACGCTTCC
TGGCACGCTACGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGGCGTCGTCCGACCCTGTGA